PF07593 - UNI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PF07593 - (441-556) ASPIC/UnbV

UniProt:	Q1ITH1	Sequences: EDLDGSPTILRNKGVPGNHWVSFELAGTKSNRLALNAKVKITAGGVTQTDEIHSGGSYLSQNDLRVHFGLGTATKIDSVEVRWPSGKVDTVKDIQADHYYAILEGKGIVSGLSRSH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	116 (102)
Sequences:	34898 (25463)
Seq/√Len:	2521.2
META:	0.945

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_S	99_Y	2.883	1.00
42_T	78_S	2.503	1.00
78_S	90_T	2.382	1.00
19_H	97_D	2.331	1.00
40_K	82_R	2.249	1.00
40_K	80_E	2.182	1.00
40_K	47_T	2.003	1.00
26_A	101_A	1.982	1.00
42_T	47_T	1.971	1.00
80_E	88_V	1.967	1.00
26_A	103_L	1.907	1.00
82_R	88_V	1.868	1.00
85_S	104_E	1.775	1.00
39_V	66_V	1.769	1.00
24_E	101_A	1.761	1.00
80_E	90_T	1.739	1.00
103_L	106_K	1.720	1.00
22_S	67_H	1.675	1.00
42_T	80_E	1.637	1.00
50_D	68_F	1.609	1.00
40_K	49_T	1.585	1.00
22_S	65_R	1.553	1.00
38_K	49_T	1.518	1.00
31_N	34_A	1.459	1.00
91_V	102_I	1.451	1.00
78_S	92_K	1.449	1.00
43_A	48_Q	1.437	1.00
24_E	99_Y	1.415	1.00
38_K	51_E	1.411	1.00
94_I	100_Y	1.366	1.00
24_E	65_R	1.357	1.00
23_F	79_V	1.355	1.00
41_I	68_F	1.345	1.00
75_K	93_D	1.342	1.00
33_L	64_L	1.333	1.00
89_D	105_G	1.309	1.00
52_I	66_V	1.301	1.00
50_D	66_V	1.262	1.00
83_W	89_D	1.243	1.00
28_T	104_E	1.210	1.00
65_R	99_Y	1.189	1.00
38_K	82_R	1.158	1.00
37_A	81_V	1.120	1.00
27_G	104_E	1.115	1.00
23_F	100_Y	1.109	1.00
43_A	46_V	1.094	1.00
44_G	73_A	1.092	1.00
95_Q	98_H	1.090	1.00
28_T	103_L	1.070	1.00
44_G	77_D	1.057	1.00
43_A	73_A	1.054	1.00
42_T	77_D	1.053	1.00
87_K	104_E	1.032	1.00
79_V	94_I	1.021	1.00
46_V	73_A	1.016	1.00
5_G	8_T	1.003	1.00
19_H	96_A	1.003	1.00
25_L	37_A	0.999	1.00
23_F	39_V	0.999	1.00
31_N	35_L	0.994	1.00
25_L	52_I	0.990	1.00
18_N	72_T	0.976	1.00
70_L	96_A	0.967	1.00
45_G	73_A	0.966	1.00
91_V	94_I	0.944	1.00
22_S	63_D	0.942	1.00
25_L	34_A	0.937	1.00
61_Q	64_L	0.925	1.00
18_N	71_G	0.920	1.00
21_V	100_Y	0.900	1.00
56_G	62_N	0.893	1.00
27_G	31_N	0.883	1.00
55_G	61_Q	0.879	1.00
70_L	76_I	0.876	1.00
73_A	77_D	0.876	1.00
29_K	87_K	0.872	1.00
81_V	102_I	0.864	1.00
26_A	32_R	0.850	1.00
48_Q	68_F	0.848	1.00
21_V	76_I	0.831	1.00
95_Q	100_Y	0.824	1.00
30_S	85_S	0.824	1.00
25_L	39_V	0.821	1.00
20_W	97_D	0.820	1.00
76_I	96_A	0.817	1.00
53_H	56_G	0.812	1.00
63_D	67_H	0.809	1.00
75_K	95_Q	0.809	1.00
19_H	74_T	0.800	1.00
41_I	76_I	0.785	1.00
52_I	64_L	0.778	1.00
35_L	54_S	0.766	1.00
41_I	70_L	0.743	1.00
37_A	84_P	0.740	1.00
54_S	61_Q	0.724	1.00
30_S	104_E	0.722	1.00
41_I	79_V	0.722	1.00
56_G	59_L	0.720	1.00
27_G	34_A	0.713	1.00
8_T	11_R	0.712	1.00
34_A	37_A	0.712	1.00
28_T	105_G	0.702	1.00
39_V	79_V	0.696	1.00
13_K	16_P	0.692	1.00
39_V	68_F	0.681	1.00
50_D	53_H	0.671	1.00
15_V	18_N	0.668	1.00
52_I	63_D	0.665	1.00
55_G	62_N	0.654	1.00
89_D	102_I	0.649	1.00
35_L	55_G	0.643	1.00
96_A	100_Y	0.641	1.00
89_D	106_K	0.619	1.00
57_S	62_N	0.600	1.00
63_D	66_V	0.594	1.00
56_G	60_S	0.593	1.00
54_S	62_N	0.589	1.00
20_W	67_H	0.588	1.00
52_I	55_G	0.580	1.00
67_H	99_Y	0.576	1.00
17_G	72_T	0.572	1.00
56_G	63_D	0.571	1.00
87_K	105_G	0.569	1.00
53_H	62_N	0.567	1.00
54_S	64_L	0.566	1.00
20_W	99_Y	0.566	1.00
52_I	65_R	0.564	1.00
43_A	77_D	0.563	1.00
30_S	84_P	0.560	1.00
25_L	83_W	0.557	1.00
91_V	105_G	0.550	1.00
35_L	64_L	0.550	1.00
23_F	66_V	0.550	1.00
37_A	52_I	0.550	1.00
81_V	91_V	0.550	1.00
25_L	89_D	0.549	1.00
27_G	33_L	0.529	1.00
34_A	52_I	0.529	1.00
58_Y	61_Q	0.529	1.00
93_D	96_A	0.528	1.00
56_G	61_Q	0.527	1.00
14_G	17_G	0.525	1.00
19_H	72_T	0.521	1.00
23_F	68_F	0.516	1.00
18_N	69_G	0.516	1.00
7_P	59_L	0.514	1.00
28_T	87_K	0.510	1.00
51_E	55_G	0.505	1.00
74_T	95_Q	0.503	1.00
35_L	52_I	0.503	1.00
51_E	82_R	0.502	1.00
14_G	18_N	0.501	1.00
50_D	55_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a7kA	2	0.7759	54.3	0.879	Contact Map
2qqrA	1	0.8534	31.1	0.896	Contact Map
2mamA	1	0.8362	21.4	0.904	Contact Map
2mcaA	1	0.5259	16.4	0.909	Contact Map
2xdpA	2	0.8276	14	0.911	Contact Map
3dmqA	1	0.5517	11.7	0.914	Contact Map
2xetA	1	0.7241	9.6	0.918	Contact Map
2e5pA	1	0.4569	7.9	0.921	Contact Map
2m0oA	1	0.6034	6.7	0.923	Contact Map
3v6cB	1	0.4052	6.2	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.