PF05284 - UNI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PF05284 - Uncharacterized protein y4eB

UniProt:	P55425	Sequences: MATIGTFTSTENGFTGSIRTLALNVKARIGRIENPSDKGPHFRIYAGAVELGAAWQKRSEQDRDYLSVKLDDPSFPAPIYATLTEVEGEDGYQLIWSRPNR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	101 (100)
Sequences:	1301 (677)
Seq/√Len:	67.7
META:

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_A	66_L	6.491	1.00
42_F	56_Q	2.898	1.00
29_I	68_V	2.697	1.00
34_N	41_H	2.564	1.00
71_D	78_P	2.455	1.00
19_R	24_N	2.250	1.00
71_D	98_R	2.145	1.00
45_Y	49_V	2.028	1.00
41_H	56_Q	2.023	1.00
17_S	26_K	1.958	1.00
29_I	44_I	1.834	1.00
22_A	74_S	1.829	1.00
59_S	62_D	1.761	1.00
44_I	70_L	1.707	1.00
21_L	25_V	1.691	0.99
56_Q	64_D	1.684	0.99
50_E	53_A	1.632	0.99
92_Y	95_I	1.601	0.99
69_K	78_P	1.591	0.99
57_K	80_Y	1.575	0.99
82_T	95_I	1.563	0.99
86_V	91_G	1.517	0.99
54_A	68_V	1.462	0.99
57_K	65_Y	1.452	0.98
86_V	93_Q	1.452	0.98
27_A	51_L	1.436	0.98
58_R	64_D	1.412	0.98
30_G	45_Y	1.381	0.98
45_Y	48_A	1.375	0.98
3_T	9_S	1.359	0.98
36_S	39_G	1.348	0.97
27_A	31_R	1.340	0.97
43_R	50_E	1.334	0.97
82_T	97_S	1.259	0.96
97_S	100_N	1.239	0.96
29_I	42_F	1.209	0.95
60_E	64_D	1.200	0.95
8_T	13_G	1.200	0.95
10_T	13_G	1.191	0.95
57_K	82_T	1.184	0.95
20_T	72_D	1.181	0.95
46_A	51_L	1.150	0.94
68_V	88_G	1.145	0.94
78_P	98_R	1.112	0.93
23_L	49_V	1.086	0.92
1_M	4_I	1.085	0.92
14_F	23_L	1.082	0.91
18_I	51_L	1.049	0.90
7_F	94_L	1.047	0.90
34_N	39_G	1.013	0.89
39_G	69_K	1.013	0.89
85_E	90_D	1.010	0.88
17_S	24_N	0.976	0.87
25_V	51_L	0.974	0.86
35_P	68_V	0.940	0.84
2_A	6_T	0.923	0.83
70_L	79_I	0.900	0.82
69_K	80_Y	0.896	0.82
83_L	94_L	0.883	0.81
67_S	97_S	0.865	0.79
82_T	92_Y	0.863	0.79
25_V	46_A	0.859	0.79
88_G	91_G	0.854	0.78
59_S	63_R	0.843	0.77
19_R	49_V	0.838	0.77
18_I	100_N	0.838	0.77
23_L	58_R	0.837	0.77
35_P	51_L	0.836	0.77
8_T	67_S	0.820	0.75
44_I	68_V	0.818	0.75
85_E	92_Y	0.815	0.75
29_I	32_I	0.797	0.73
19_R	51_L	0.797	0.73
66_L	82_T	0.786	0.72
57_K	67_S	0.784	0.72
45_Y	50_E	0.783	0.72
67_S	80_Y	0.783	0.72
18_I	27_A	0.782	0.72
8_T	90_D	0.771	0.71
56_Q	91_G	0.767	0.70
37_D	60_E	0.765	0.70
36_S	89_E	0.765	0.70
44_I	99_P	0.749	0.69
9_S	31_R	0.743	0.68
72_D	98_R	0.734	0.67
60_E	63_R	0.723	0.66
14_F	92_Y	0.719	0.65
14_F	58_R	0.711	0.65
86_V	89_E	0.706	0.64
35_P	62_D	0.704	0.64
36_S	60_E	0.703	0.64
43_R	53_A	0.694	0.63
9_S	92_Y	0.685	0.62
42_F	66_L	0.676	0.61
19_R	48_A	0.671	0.60
87_E	93_Q	0.657	0.59
39_G	71_D	0.653	0.58
44_I	58_R	0.649	0.58
68_V	94_L	0.645	0.57
21_L	86_V	0.642	0.57
80_Y	95_I	0.634	0.56
6_T	10_T	0.632	0.56
1_M	5_G	0.632	0.56
59_S	65_Y	0.627	0.55
8_T	76_P	0.624	0.55
18_I	78_P	0.622	0.54
30_G	81_A	0.622	0.54
3_T	100_N	0.621	0.54
46_A	49_V	0.615	0.54
51_L	82_T	0.608	0.53
29_I	41_H	0.605	0.52
48_A	60_E	0.605	0.52
10_T	15_T	0.598	0.52
57_K	100_N	0.597	0.51
37_D	59_S	0.597	0.51
22_A	76_P	0.597	0.51
54_A	67_S	0.595	0.51
39_G	43_R	0.594	0.51
20_T	42_F	0.577	0.49
63_R	80_Y	0.558	0.47
80_Y	85_E	0.557	0.47
7_F	98_R	0.556	0.47
39_G	84_T	0.551	0.46
79_I	93_Q	0.550	0.46
38_K	62_D	0.550	0.46
53_A	57_K	0.549	0.46
14_F	66_L	0.549	0.46
80_Y	92_Y	0.543	0.45
53_A	67_S	0.540	0.45
78_P	94_L	0.539	0.45
30_G	42_F	0.538	0.44
19_R	25_V	0.534	0.44
13_G	42_F	0.533	0.44
84_T	92_Y	0.533	0.44
38_K	61_Q	0.532	0.44
12_N	18_I	0.532	0.44
36_S	61_Q	0.532	0.44
13_G	32_I	0.531	0.44
35_P	39_G	0.528	0.43
29_I	54_A	0.527	0.43
72_D	78_P	0.527	0.43
57_K	60_E	0.526	0.43
13_G	19_R	0.522	0.43
23_L	72_D	0.513	0.42
58_R	62_D	0.510	0.41
49_V	99_P	0.506	0.41
70_L	74_S	0.504	0.40
84_T	95_I	0.501	0.40
28_R	47_G	0.500	0.40
41_H	58_R	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2nqaA	3	0.5347	16.7	0.931	Contact Map
2dlgA	1	0.6139	12.9	0.935	Contact Map
2j7nA	2	0.9109	10	0.938	Contact Map
1qxpA	1	0.7426	8.2	0.94	Contact Map
3zfdA	1	0.4059	6.6	0.943	Contact Map
1v8kA	3	0.3069	6.1	0.944	Contact Map
2r9fA	1	0.5347	5.9	0.944	Contact Map
2vrqA	1	0.901	5.9	0.944	Contact Map
3bowA	1	0.5347	5.6	0.945	Contact Map
2zfiA	1	0.2772	5.4	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.