PF14462 - UNI - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PF14462 - (1-93) Uncharacterized protein

UniProt:	C7R645	Sequences: MSNDNHDNNGSQWRFRVDKNNFTVDSPSITGREILIMAGKTPVEQYLLILSGHGQPKEISLDEKIDLSQPGIERFRTLERECREGFQGRKDFQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (78)
Sequences:	715 (580)
Seq/√Len:	65.7
META:	0.724

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_I	67_L	3.714	1.00
18_D	77_T	2.990	1.00
24_V	29_I	2.832	1.00
31_G	59_I	2.711	1.00
26_S	33_E	2.677	1.00
15_F	24_V	2.367	1.00
32_R	61_L	2.139	1.00
27_P	68_S	2.055	1.00
28_S	64_K	1.865	1.00
35_L	61_L	1.833	1.00
24_V	37_M	1.747	1.00
17_V	34_I	1.729	1.00
14_R	21_N	1.715	0.99
57_K	63_E	1.709	0.99
18_D	40_K	1.620	0.99
32_R	62_D	1.594	0.99
66_D	71_G	1.585	0.99
48_L	77_T	1.580	0.99
28_S	66_D	1.556	0.99
16_R	74_R	1.409	0.98
40_K	77_T	1.356	0.97
33_E	64_K	1.303	0.97
34_I	38_A	1.278	0.96
14_R	23_T	1.269	0.96
32_R	36_I	1.253	0.96
30_T	33_E	1.239	0.95
27_P	66_D	1.198	0.94
78_L	81_E	1.182	0.94
59_I	65_I	1.174	0.94
79_E	82_C	1.135	0.93
22_F	38_A	1.106	0.92
17_V	20_N	1.105	0.92
34_I	48_L	1.099	0.91
26_S	29_I	1.091	0.91
30_T	62_D	1.058	0.90
50_L	69_Q	1.036	0.89
16_R	19_K	1.027	0.88
30_T	64_K	1.012	0.88
70_P	73_E	1.009	0.88
12_Q	23_T	0.989	0.86
57_K	69_Q	0.982	0.86
50_L	65_I	0.960	0.85
36_I	41_T	0.956	0.85
31_G	75_F	0.948	0.84
12_Q	25_D	0.947	0.84
43_V	61_L	0.941	0.84
49_I	76_R	0.926	0.83
8_N	13_W	0.913	0.82
58_E	61_L	0.889	0.80
78_L	82_C	0.879	0.79
15_F	34_I	0.871	0.79
28_S	68_S	0.846	0.77
35_L	77_T	0.823	0.75
31_G	62_D	0.821	0.74
35_L	40_K	0.801	0.73
38_A	77_T	0.791	0.72
49_I	56_P	0.784	0.71
64_K	72_I	0.773	0.70
18_D	75_F	0.771	0.70
27_P	70_P	0.770	0.70
33_E	36_I	0.746	0.67
56_P	78_L	0.733	0.66
47_L	80_R	0.723	0.65
29_I	37_M	0.722	0.65
51_S	79_E	0.714	0.64
31_G	34_I	0.712	0.64
78_L	84_E	0.709	0.63
36_I	39_G	0.709	0.63
68_S	71_G	0.706	0.63
17_V	48_L	0.702	0.62
56_P	76_R	0.700	0.62
34_I	75_F	0.696	0.62
9_N	27_P	0.690	0.61
18_D	34_I	0.687	0.61
57_K	60_S	0.686	0.61
81_E	84_E	0.685	0.61
10_G	13_W	0.683	0.60
51_S	78_L	0.675	0.59
15_F	37_M	0.668	0.59
65_I	75_F	0.667	0.58
22_F	33_E	0.662	0.58
19_K	74_R	0.657	0.57
20_N	25_D	0.651	0.57
46_Y	77_T	0.636	0.55
8_N	25_D	0.634	0.55
65_I	70_P	0.627	0.54
47_L	58_E	0.627	0.54
13_W	18_D	0.623	0.53
52_G	69_Q	0.622	0.53
52_G	55_Q	0.613	0.52
66_D	70_P	0.605	0.51
17_V	22_F	0.604	0.51
17_V	30_T	0.604	0.51
27_P	54_G	0.601	0.51
47_L	55_Q	0.592	0.50
60_S	63_E	0.575	0.48
66_D	69_Q	0.573	0.48
58_E	80_R	0.570	0.47
29_I	77_T	0.570	0.47
16_R	21_N	0.569	0.47
68_S	74_R	0.568	0.47
12_Q	59_I	0.561	0.46
11_S	36_I	0.561	0.46
10_G	21_N	0.558	0.46
31_G	48_L	0.556	0.46
12_Q	74_R	0.551	0.45
46_Y	84_E	0.543	0.44
46_Y	52_G	0.540	0.44
55_Q	74_R	0.529	0.42
78_L	83_R	0.526	0.42
11_S	65_I	0.518	0.41
44_E	80_R	0.512	0.40
17_V	21_N	0.508	0.40
56_P	60_S	0.502	0.39
49_I	58_E	0.502	0.39
46_Y	85_G	0.501	0.39
22_F	39_G	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2cu3A	2	0.6022	17.5	0.895	Contact Map
1tygB	1	0.6129	13.5	0.901	Contact Map
1rqbA	2	0.0215	12.1	0.903	Contact Map
2lekA	1	0.6989	10.3	0.906	Contact Map
1f0zA	1	0.6237	9.5	0.907	Contact Map
1z4hA	1	0.7097	6.8	0.913	Contact Map
3wfpA	2	0.2903	5.2	0.917	Contact Map
2d5uA	1	0.8495	4.3	0.921	Contact Map
2k5pA	1	0.7097	3.9	0.923	Contact Map
4hdoA	1	0.9247	3.7	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.