PAAD - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PAAD - Probable aromatic acid decarboxylase

UniProt:	Q9Y8K8	Sequences: MVKEAGTKNRREKTKRIIIGISGASGTIYGIRTVQFLNELGYEIHIIISKSAEKVAQKELGINLINELKKYSSYIYNQSQIEASPSSSSFSITSKGMIIIPCSIKTLAEIANGIGSNLLSRTALNFIRTNKRLVLVIRETPLGAIELENALKLARLGVYIMPASPAFYILPKNIDDMINFIVGKALDLLGIKHDIYKRWKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	201 (182)
Sequences:	1844 (1207)
Seq/√Len:	89.5

ECOLI - UBIX
BACSU - BSDB
SULSO - PAAD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
148_E	155_R	3.162	1.00
144_A	154_A	3.061	1.00
107_L	150_A	3.036	1.00
148_E	152_K	2.915	1.00
153_L	158_V	2.856	1.00
16_R	43_E	2.725	1.00
32_R	179_N	2.621	1.00
144_A	151_L	2.563	1.00
144_A	155_R	2.445	1.00
20_G	119_L	2.372	1.00
32_R	35_Q	2.322	1.00
47_I	85_P	2.294	1.00
183_G	196_Y	2.227	1.00
187_D	198_R	2.226	1.00
108_A	114_I	2.195	1.00
100_I	136_V	2.158	1.00
21_I	30_G	2.026	1.00
22_S	119_L	1.978	1.00
45_H	76_Y	1.961	1.00
147_L	151_L	1.955	1.00
98_I	185_A	1.879	1.00
104_I	137_I	1.878	1.00
51_S	81_I	1.860	1.00
76_Y	84_S	1.842	1.00
33_T	98_I	1.731	1.00
142_L	164_S	1.678	1.00
130_N	154_A	1.672	1.00
127_I	158_V	1.643	1.00
49_S	119_L	1.641	1.00
174_I	177_M	1.573	1.00
151_L	155_R	1.569	1.00
97_M	126_F	1.569	1.00
175_D	179_N	1.519	1.00
102_C	107_L	1.515	1.00
144_A	156_L	1.509	1.00
93_T	192_K	1.508	1.00
148_E	151_L	1.493	1.00
100_I	185_A	1.468	0.99
94_S	126_F	1.467	0.99
184_K	196_Y	1.455	0.99
109_E	114_I	1.446	0.99
136_V	185_A	1.429	0.99
107_L	153_L	1.429	0.99
153_L	160_I	1.403	0.99
19_I	34_V	1.403	0.99
130_N	159_Y	1.399	0.99
61_G	170_L	1.391	0.99
134_V	189_L	1.366	0.99
27_T	56_A	1.362	0.99
17_I	189_L	1.358	0.99
78_Q	117_N	1.346	0.99
159_Y	188_L	1.344	0.99
50_K	79_S	1.324	0.99
172_K	176_D	1.320	0.99
96_G	189_L	1.317	0.99
30_G	100_I	1.304	0.99
113_G	149_N	1.304	0.99
124_L	146_E	1.293	0.99
108_A	149_N	1.214	0.98
105_K	114_I	1.201	0.98
108_A	112_N	1.191	0.98
33_T	100_I	1.187	0.98
161_M	181_I	1.178	0.98
99_I	110_I	1.176	0.98
50_K	78_Q	1.176	0.98
56_A	60_L	1.176	0.98
45_H	90_F	1.174	0.98
33_T	182_V	1.166	0.97
15_K	95_K	1.156	0.97
145_I	149_N	1.154	0.97
98_I	189_L	1.140	0.97
115_G	124_L	1.136	0.97
109_E	116_S	1.130	0.97
18_I	126_F	1.122	0.97
104_I	149_N	1.119	0.97
136_V	181_I	1.111	0.97
105_K	120_S	1.106	0.96
167_F	178_I	1.105	0.96
29_Y	165_P	1.096	0.96
29_Y	163_A	1.092	0.96
127_I	156_L	1.091	0.96
18_I	94_S	1.080	0.96
110_I	123_A	1.077	0.96
113_G	145_I	1.074	0.96
137_I	161_M	1.074	0.96
93_T	190_G	1.072	0.96
183_G	193_H	1.064	0.96
40_L	191_I	1.057	0.95
145_I	156_L	1.053	0.95
19_I	100_I	1.047	0.95
153_L	156_L	1.038	0.95
132_R	188_L	1.032	0.95
19_I	44_I	1.029	0.95
34_V	44_I	1.025	0.95
136_V	163_A	1.016	0.94
97_M	122_T	1.013	0.94
104_I	108_A	1.010	0.94
33_T	185_A	0.988	0.93
28_I	178_I	0.978	0.93
36_F	195_I	0.975	0.93
127_I	143_G	0.973	0.93
50_K	53_E	0.971	0.93
140_T	161_M	0.968	0.93
18_I	85_P	0.965	0.93
105_K	109_E	0.959	0.92
76_Y	80_Q	0.954	0.92
36_F	39_E	0.953	0.92
154_A	158_V	0.947	0.92
16_R	95_K	0.940	0.92
109_E	120_S	0.927	0.91
166_A	180_F	0.924	0.91
82_E	86_S	0.920	0.91
53_E	69_K	0.909	0.90
31_I	56_A	0.904	0.90
97_M	123_A	0.902	0.90
140_T	181_I	0.895	0.90
32_R	175_D	0.891	0.89
21_I	52_A	0.887	0.89
144_A	158_V	0.884	0.89
116_S	120_S	0.881	0.89
154_A	160_I	0.881	0.89
132_R	190_G	0.880	0.89
104_I	146_E	0.878	0.89
126_F	133_L	0.878	0.89
161_M	184_K	0.867	0.88
57_Q	63_N	0.867	0.88
90_F	94_S	0.858	0.87
171_P	176_D	0.857	0.87
161_M	185_A	0.848	0.87
99_I	123_A	0.847	0.87
107_L	149_N	0.847	0.87
163_A	181_I	0.845	0.87
34_V	46_I	0.843	0.87
136_V	161_M	0.842	0.86
58_K	82_E	0.837	0.86
143_G	149_N	0.836	0.86
55_V	105_K	0.834	0.86
54_K	81_I	0.832	0.86
88_S	128_R	0.831	0.86
152_K	156_L	0.829	0.86
134_V	188_L	0.826	0.85
29_Y	181_I	0.825	0.85
48_I	52_A	0.820	0.85
86_S	118_L	0.819	0.85
38_N	73_S	0.818	0.85
54_K	58_K	0.808	0.84
105_K	124_L	0.806	0.84
46_I	72_S	0.804	0.84
102_C	135_L	0.795	0.83
42_Y	95_K	0.793	0.83
88_S	129_T	0.793	0.83
42_Y	191_I	0.792	0.83
20_G	97_M	0.787	0.82
111_A	152_K	0.786	0.82
147_L	153_L	0.783	0.82
88_S	125_N	0.771	0.81
161_M	188_L	0.770	0.81
21_I	27_T	0.770	0.81
31_I	60_L	0.770	0.81
54_K	57_Q	0.769	0.81
110_I	135_L	0.764	0.81
25_S	51_S	0.764	0.81
149_N	153_L	0.758	0.80
67_E	70_K	0.752	0.80
117_N	120_S	0.751	0.79
97_M	133_L	0.751	0.79
115_G	120_S	0.750	0.79
135_L	153_L	0.740	0.78
152_K	155_R	0.738	0.78
112_N	149_N	0.736	0.78
180_F	196_Y	0.733	0.78
32_R	182_V	0.730	0.78
50_K	54_K	0.728	0.77
122_T	126_F	0.728	0.77
125_N	128_R	0.727	0.77
137_I	164_S	0.723	0.77
93_T	131_K	0.712	0.76
48_I	68_L	0.711	0.76
90_F	93_T	0.710	0.76
99_I	135_L	0.707	0.75
36_F	179_N	0.706	0.75
74_Y	84_S	0.704	0.75
46_I	75_I	0.696	0.74
137_I	142_L	0.693	0.74
17_I	42_Y	0.687	0.73
43_E	90_F	0.685	0.73
184_K	188_L	0.680	0.72
48_I	75_I	0.678	0.72
114_I	117_N	0.678	0.72
43_E	74_Y	0.677	0.72
126_F	131_K	0.676	0.72
125_N	129_T	0.675	0.72
109_E	117_N	0.674	0.72
66_N	69_K	0.673	0.72
144_A	153_L	0.672	0.71
36_F	182_V	0.667	0.71
69_K	75_I	0.666	0.71
163_A	180_F	0.665	0.71
18_I	97_M	0.651	0.69
72_S	75_I	0.647	0.69
15_K	41_G	0.646	0.69
48_I	56_A	0.646	0.69
173_N	176_D	0.641	0.68
54_K	82_E	0.641	0.68
29_Y	178_I	0.639	0.68
98_I	134_V	0.637	0.67
36_F	193_H	0.634	0.67
165_P	177_M	0.629	0.66
18_I	47_I	0.627	0.66
109_E	146_E	0.618	0.65
31_I	35_Q	0.615	0.65
113_G	143_G	0.615	0.65
111_A	153_L	0.614	0.65
137_I	147_L	0.613	0.64
79_S	82_E	0.612	0.64
108_A	111_A	0.611	0.64
27_T	30_G	0.601	0.63
102_C	150_A	0.600	0.63
53_E	78_Q	0.595	0.62
16_R	93_T	0.595	0.62
21_I	48_I	0.593	0.62
62_I	68_L	0.593	0.62
29_Y	167_F	0.587	0.61
105_K	115_G	0.586	0.61
179_N	182_V	0.584	0.61
123_A	133_L	0.584	0.61
17_I	96_G	0.578	0.60
33_T	186_L	0.578	0.60
27_T	52_A	0.576	0.60
96_G	131_K	0.576	0.60
32_R	178_I	0.575	0.60
81_I	86_S	0.573	0.59
165_P	184_K	0.573	0.59
128_R	146_E	0.570	0.59
176_D	179_N	0.568	0.59
22_S	103_S	0.566	0.58
16_R	45_H	0.560	0.58
108_A	113_G	0.557	0.57
90_F	96_G	0.552	0.56
193_H	198_R	0.551	0.56
55_V	163_A	0.550	0.56
124_L	143_G	0.550	0.56
47_I	82_E	0.546	0.56
35_Q	62_I	0.544	0.55
115_G	143_G	0.541	0.55
130_N	188_L	0.540	0.55
164_S	181_I	0.539	0.55
135_L	160_I	0.527	0.53
79_S	172_K	0.526	0.53
18_I	122_T	0.525	0.53
52_A	58_K	0.524	0.53
104_I	124_L	0.523	0.53
45_H	74_Y	0.521	0.52
166_A	177_M	0.521	0.52
102_C	106_T	0.521	0.52
169_I	196_Y	0.519	0.52
48_I	51_S	0.517	0.52
93_T	198_R	0.515	0.51
151_L	154_A	0.513	0.51
86_S	94_S	0.511	0.51
43_E	95_K	0.510	0.51
140_T	162_P	0.510	0.51
99_I	106_T	0.510	0.51
187_D	196_Y	0.507	0.50
16_R	90_F	0.505	0.50
103_S	164_S	0.505	0.50
38_N	105_K	0.503	0.50
171_P	174_I	0.503	0.50
60_L	68_L	0.502	0.50
63_N	67_E	0.501	0.50
29_Y	111_A	0.501	0.50
34_V	41_G	0.501	0.50
31_I	62_I	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rhfA	6	0.9303	100	0.348	Contact Map
4zavA	6	0.9403	100	0.349	Contact Map
2ejbA	6	0.8557	100	0.36	Contact Map
1sbzA	6	0.9154	100	0.362	Contact Map
3lqkA	5	0.9254	100	0.499	Contact Map
3mcuA	5	0.8756	100	0.527	Contact Map
1g63A	6	0.7662	100	0.54	Contact Map
1qzuA	3	0.7164	100	0.543	Contact Map
1p3y1	6	0.8159	100	0.56	Contact Map
3wisA	4	0.8109	100	0.568	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.