PSB2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSB2 - Proteasome subunit beta 2

UniProt:	Q9UXF3	Sequences: MGNELQLENKILKGTTTVGIRVNDGVILAADRRASAGFFVANKMVRKVLYITDKIGITTAGSVADLQFIYDVLKNIYHYNSITKYGPISIKGIATRLANVLSATKYFPYIVQILIGGYDDQPRLFNLDYLGDITEENYVATGSGSPVAMGVLEDEYNPKMTLDEAADLAKRAVFSAIKRDSFTGTGVIVAKIHSKGHEELEFYLNKKM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (188)
Sequences:	4338 (2462)
Seq/√Len:	179.5

HALSA - PSA PSB
SULSO - PSB2 PSA PSB1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
161_T	164_E	5.033	1.00
29_A	169_A	3.734	1.00
19_G	28_L	3.104	1.00
23_N	159_K	3.064	1.00
22_V	25_G	2.709	1.00
123_R	135_E	2.660	1.00
17_T	58_T	2.405	1.00
22_V	165_A	2.396	1.00
19_G	124_L	2.385	1.00
155_E	171_R	2.369	1.00
162_L	193_H	2.366	1.00
81_S	87_P	2.309	1.00
55_I	90_I	2.215	1.00
193_H	196_G	2.190	1.00
162_L	166_A	2.152	1.00
137_N	158_P	2.111	1.00
157_N	164_E	2.093	1.00
28_L	116_G	2.055	1.00
50_Y	53_D	2.038	1.00
20_I	169_A	1.986	1.00
24_D	194_S	1.915	1.00
90_I	117_G	1.908	1.00
26_V	116_G	1.881	1.00
162_L	198_E	1.836	1.00
52_T	81_S	1.817	1.00
21_R	135_E	1.816	1.00
160_M	168_L	1.804	1.00
23_N	161_T	1.795	1.00
55_I	93_I	1.765	1.00
114_L	139_V	1.749	1.00
193_H	198_E	1.735	1.00
54_K	87_P	1.730	1.00
102_S	105_K	1.718	1.00
125_F	135_E	1.701	1.00
27_I	169_A	1.623	1.00
27_I	166_A	1.576	1.00
20_I	165_A	1.571	1.00
89_S	92_G	1.568	1.00
155_E	168_L	1.563	1.00
102_S	106_Y	1.554	1.00
73_L	97_L	1.542	1.00
27_I	191_K	1.542	1.00
166_A	191_K	1.504	1.00
22_V	162_L	1.483	1.00
77_Y	93_I	1.454	1.00
157_N	160_M	1.446	1.00
22_V	193_H	1.421	1.00
112_Q	129_Y	1.420	1.00
156_Y	159_K	1.418	1.00
24_D	162_L	1.416	1.00
94_A	133_I	1.406	1.00
166_A	189_V	1.405	1.00
25_G	165_A	1.389	1.00
16_T	144_G	1.369	1.00
190_A	199_E	1.366	1.00
21_R	137_N	1.346	1.00
59_T	66_L	1.323	1.00
167_D	171_R	1.315	1.00
48_V	190_A	1.296	1.00
46_R	188_I	1.286	1.00
88_I	93_I	1.286	1.00
57_I	70_Y	1.280	1.00
57_I	115_I	1.265	1.00
52_T	87_P	1.234	1.00
156_Y	160_M	1.228	1.00
29_A	189_V	1.210	1.00
104_T	109_Y	1.210	1.00
151_V	172_A	1.205	1.00
140_A	152_L	1.203	1.00
69_I	111_V	1.174	1.00
151_V	155_E	1.172	1.00
72_V	76_I	1.168	1.00
76_I	79_Y	1.139	1.00
25_G	162_L	1.133	1.00
163_D	167_D	1.132	1.00
170_K	187_V	1.130	1.00
76_I	96_R	1.118	1.00
27_I	165_A	1.117	1.00
195_K	198_E	1.108	1.00
72_V	100_V	1.103	1.00
32_R	188_I	1.095	1.00
34_A	45_V	1.093	1.00
171_R	174_F	1.065	1.00
80_N	84_K	1.062	1.00
114_L	141_T	1.057	1.00
21_R	122_P	1.055	1.00
26_V	124_L	1.052	1.00
49_L	70_Y	1.050	1.00
118_Y	194_S	1.047	1.00
33_R	40_V	1.041	1.00
51_I	57_I	1.038	1.00
119_D	123_R	1.025	0.99
36_A	41_A	1.021	0.99
101_L	113_I	1.017	0.99
51_I	77_Y	1.001	0.99
16_T	148_A	0.997	0.99
167_D	170_K	0.993	0.99
96_R	100_V	0.990	0.99
90_I	123_R	0.984	0.99
128_D	132_D	0.977	0.99
126_N	139_V	0.973	0.99
152_L	172_A	0.963	0.99
18_V	152_L	0.963	0.99
170_K	189_V	0.963	0.99
103_A	107_F	0.961	0.99
138_Y	152_L	0.959	0.99
188_I	199_E	0.954	0.99
172_A	176_A	0.950	0.99
28_L	56_G	0.949	0.99
56_G	192_I	0.948	0.99
56_G	190_A	0.934	0.99
48_V	58_T	0.926	0.99
115_I	127_L	0.917	0.99
70_Y	74_K	0.915	0.99
75_N	79_Y	0.913	0.99
52_T	55_I	0.912	0.99
101_L	127_L	0.911	0.99
100_V	103_A	0.905	0.99
164_E	167_D	0.895	0.99
28_L	58_T	0.885	0.98
60_A	141_T	0.883	0.98
163_D	166_A	0.862	0.98
56_G	197_H	0.858	0.98
66_L	111_V	0.854	0.98
79_Y	83_T	0.843	0.98
180_D	183_T	0.838	0.98
28_L	190_A	0.829	0.98
54_K	88_I	0.827	0.98
88_I	92_G	0.826	0.98
160_M	164_E	0.825	0.98
126_N	136_E	0.820	0.97
78_H	81_S	0.819	0.97
148_A	172_A	0.819	0.97
79_Y	82_I	0.818	0.97
26_V	122_P	0.812	0.97
105_K	110_I	0.812	0.97
32_R	186_G	0.810	0.97
49_L	59_T	0.808	0.97
49_L	68_F	0.798	0.97
118_Y	122_P	0.794	0.97
164_E	168_L	0.793	0.97
89_S	120_D	0.787	0.97
114_L	124_L	0.785	0.97
151_V	168_L	0.779	0.97
171_R	175_S	0.779	0.97
33_R	184_G	0.778	0.97
162_L	165_A	0.777	0.97
97_L	115_I	0.774	0.96
55_I	115_I	0.769	0.96
75_N	78_H	0.769	0.96
17_T	30_A	0.767	0.96
153_E	179_R	0.760	0.96
57_I	113_I	0.760	0.96
54_K	120_D	0.756	0.96
80_N	92_G	0.751	0.96
15_T	31_D	0.749	0.96
94_A	125_F	0.749	0.96
174_F	177_I	0.745	0.96
27_I	162_L	0.735	0.95
80_N	88_I	0.732	0.95
35_S	40_V	0.730	0.95
90_I	115_I	0.726	0.95
116_G	192_I	0.723	0.95
176_A	180_D	0.720	0.95
160_M	165_A	0.720	0.95
78_H	82_I	0.717	0.95
98_A	133_I	0.717	0.95
65_D	108_P	0.716	0.95
138_Y	149_M	0.714	0.94
30_A	60_A	0.713	0.94
86_G	120_D	0.712	0.94
62_S	65_D	0.710	0.94
50_Y	199_E	0.710	0.94
48_V	56_G	0.709	0.94
69_I	97_L	0.709	0.94
112_Q	141_T	0.700	0.94
97_L	113_I	0.700	0.94
63_V	66_L	0.696	0.94
33_R	143_S	0.696	0.94
136_E	139_V	0.691	0.93
47_K	156_Y	0.687	0.93
111_V	152_L	0.685	0.93
23_N	158_P	0.677	0.93
180_D	184_G	0.677	0.93
190_A	197_H	0.675	0.93
26_V	29_A	0.671	0.92
140_A	148_A	0.668	0.92
18_V	39_F	0.667	0.92
18_V	169_A	0.662	0.92
80_N	89_S	0.659	0.92
192_I	197_H	0.656	0.92
61_G	65_D	0.655	0.92
106_Y	130_L	0.652	0.91
72_V	96_R	0.649	0.91
20_I	29_A	0.648	0.91
151_V	175_S	0.645	0.91
162_L	191_K	0.644	0.91
194_S	199_E	0.641	0.91
88_I	96_R	0.636	0.90
129_Y	141_T	0.632	0.90
17_T	114_L	0.629	0.90
89_S	94_A	0.629	0.90
30_A	48_V	0.625	0.90
66_L	70_Y	0.622	0.89
51_I	74_K	0.622	0.89
161_T	165_A	0.621	0.89
118_Y	192_I	0.619	0.89
53_D	87_P	0.618	0.89
99_N	103_A	0.617	0.89
13_K	150_G	0.612	0.89
59_T	113_I	0.612	0.89
91_K	95_T	0.611	0.88
163_D	195_K	0.598	0.87
19_G	116_G	0.598	0.87
73_L	96_R	0.598	0.87
92_G	95_T	0.597	0.87
170_K	174_F	0.597	0.87
144_G	148_A	0.589	0.87
61_G	131_G	0.587	0.86
64_A	132_D	0.584	0.86
97_L	127_L	0.583	0.86
77_Y	99_N	0.582	0.86
42_N	45_V	0.580	0.86
170_K	173_V	0.579	0.86
104_T	127_L	0.577	0.85
120_D	123_R	0.572	0.85
47_K	60_A	0.572	0.85
51_I	93_I	0.572	0.85
59_T	64_A	0.570	0.85
69_I	101_L	0.570	0.85
121_Q	194_S	0.570	0.85
22_V	191_K	0.569	0.85
62_S	68_F	0.568	0.85
32_R	173_V	0.567	0.85
78_H	83_T	0.565	0.84
72_V	75_N	0.560	0.84
132_D	139_V	0.560	0.84
78_H	86_G	0.556	0.83
95_T	133_I	0.554	0.83
177_I	180_D	0.553	0.83
79_Y	150_G	0.552	0.83
191_K	198_E	0.549	0.83
36_A	178_K	0.549	0.83
87_P	121_Q	0.549	0.83
18_V	29_A	0.547	0.82
76_I	100_V	0.546	0.82
131_G	142_G	0.545	0.82
33_R	180_D	0.545	0.82
48_V	188_I	0.543	0.82
107_F	111_V	0.542	0.82
37_G	42_N	0.541	0.82
103_A	167_D	0.540	0.82
125_F	133_I	0.536	0.81
100_V	109_Y	0.533	0.81
191_K	194_S	0.531	0.80
138_Y	156_Y	0.529	0.80
23_N	53_D	0.529	0.80
118_Y	196_G	0.528	0.80
143_S	147_V	0.525	0.80
46_R	49_L	0.525	0.80
60_A	132_D	0.525	0.80
126_N	134_T	0.524	0.80
36_A	39_F	0.520	0.79
140_A	145_S	0.519	0.79
81_S	85_Y	0.518	0.79
24_D	193_H	0.517	0.79
22_V	27_I	0.517	0.79
95_T	98_A	0.517	0.79
149_M	179_R	0.516	0.79
108_P	112_Q	0.515	0.78
120_D	194_S	0.514	0.78
71_D	146_P	0.513	0.78
166_A	170_K	0.510	0.78
11_I	98_A	0.509	0.78
21_R	158_P	0.508	0.78
151_V	171_R	0.507	0.77
75_N	80_N	0.505	0.77
64_A	178_K	0.505	0.77
57_I	73_L	0.503	0.77
144_G	147_V	0.502	0.77
196_G	199_E	0.500	0.76
15_T	60_A	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rypC	1	1	100	0.123	Contact Map
1j2pA	3	0.9904	100	0.123	Contact Map
4r3oC	1	1	100	0.131	Contact Map
4r3oB	1	0.9808	100	0.137	Contact Map
4r3oE	1	0.9856	100	0.139	Contact Map
3h4pA	3	0.9856	100	0.139	Contact Map
1rypE	1	0.9856	100	0.142	Contact Map
1rypB	1	0.9904	100	0.142	Contact Map
4r3oA	1	0.9904	100	0.149	Contact Map
1rypF	1	0.9808	100	0.149	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.