RL21 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL21 - 50S ribosomal protein L21e

UniProt:	Q9UXE0	Sequences: MVKHSKGYRTRSRSLLRKSPRERGAVPSLSKLMVEYKEGDNVVVKINPSVHQGMPHRRYQGKVGKIIGKRGRAYLVSVTLGDKEKVIIVRPEHLVPFNSSG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	101 (94)
Sequences:	484 (265)
Seq/√Len:	27.3

HALSA - RL21
SULSO - RL21

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_H	10_T	3.400	1.00
18_K	47_N	2.544	0.99
27_P	30_S	2.465	0.99
6_K	10_T	2.372	0.99
13_R	90_R	2.226	0.98
74_Y	94_L	2.119	0.97
34_V	96_P	1.943	0.95
38_E	72_R	1.882	0.94
81_G	84_E	1.852	0.94
9_R	64_G	1.850	0.94
67_I	88_I	1.823	0.93
61_G	64_G	1.818	0.93
31_K	47_N	1.766	0.92
45_K	60_Q	1.759	0.92
36_Y	96_P	1.678	0.90
5_S	10_T	1.599	0.88
10_T	65_K	1.565	0.87
6_K	11_R	1.530	0.85
19_S	22_E	1.523	0.85
41_N	96_P	1.501	0.84
77_S	88_I	1.458	0.83
42_V	93_H	1.452	0.82
49_S	76_V	1.437	0.82
43_V	63_V	1.423	0.81
11_R	14_S	1.413	0.80
5_S	73_A	1.401	0.80
82_D	86_V	1.399	0.80
4_H	11_R	1.387	0.79
18_K	48_P	1.345	0.77
22_E	25_A	1.328	0.76
37_K	40_D	1.324	0.76
31_K	95_V	1.318	0.76
39_G	42_V	1.314	0.75
42_V	61_G	1.308	0.75
68_G	88_I	1.267	0.73
41_N	65_K	1.256	0.72
45_K	95_V	1.196	0.68
42_V	89_V	1.184	0.67
15_L	78_V	1.169	0.66
18_K	27_P	1.169	0.66
68_G	94_L	1.154	0.65
17_R	98_N	1.138	0.64
63_V	97_F	1.136	0.64
52_Q	93_H	1.136	0.64
33_M	39_G	1.088	0.61
44_V	62_K	1.079	0.60
16_L	64_G	1.067	0.59
22_E	35_E	1.046	0.58
48_P	65_K	1.035	0.57
43_V	97_F	1.028	0.56
24_G	76_V	1.027	0.56
17_R	87_I	1.012	0.55
12_S	60_Q	1.010	0.55
11_R	19_S	1.008	0.55
90_R	93_H	0.994	0.54
68_G	85_K	0.978	0.52
21_R	24_G	0.972	0.52
13_R	49_S	0.958	0.51
30_S	33_M	0.943	0.50
75_L	88_I	0.942	0.50
16_L	74_Y	0.940	0.50
45_K	59_Y	0.938	0.49
32_L	91_P	0.917	0.48
58_R	81_G	0.906	0.47
70_R	88_I	0.901	0.47
70_R	94_L	0.882	0.45
4_H	46_I	0.876	0.45
39_G	90_R	0.872	0.44
27_P	50_V	0.869	0.44
15_L	57_R	0.859	0.43
92_E	97_F	0.842	0.42
79_T	87_I	0.837	0.42
26_V	30_S	0.831	0.41
72_R	86_V	0.831	0.41
26_V	50_V	0.822	0.41
8_Y	49_S	0.809	0.40
23_R	81_G	0.802	0.39
31_K	34_V	0.787	0.38
38_E	71_G	0.777	0.37
42_V	53_G	0.765	0.37
80_L	85_K	0.753	0.36
42_V	55_P	0.753	0.36
15_L	98_N	0.750	0.36
41_N	98_N	0.748	0.35
26_V	81_G	0.723	0.34
26_V	33_M	0.719	0.33
19_S	92_E	0.710	0.33
24_G	39_G	0.703	0.32
6_K	84_E	0.703	0.32
43_V	52_Q	0.701	0.32
30_S	38_E	0.695	0.32
26_V	29_L	0.694	0.32
44_V	93_H	0.691	0.32
38_E	46_I	0.689	0.31
80_L	97_F	0.678	0.31
37_K	62_K	0.676	0.31
50_V	65_K	0.675	0.31
50_V	79_T	0.671	0.30
4_H	79_T	0.671	0.30
16_L	20_P	0.665	0.30
22_E	74_Y	0.646	0.29
4_H	57_R	0.641	0.28
66_I	72_R	0.638	0.28
6_K	65_K	0.638	0.28
41_N	51_H	0.634	0.28
13_R	76_V	0.633	0.28
4_H	51_H	0.622	0.27
9_R	61_G	0.620	0.27
10_T	46_I	0.617	0.27
61_G	93_H	0.615	0.27
54_M	93_H	0.611	0.27
57_R	74_Y	0.607	0.26
17_R	74_Y	0.600	0.26
75_L	85_K	0.600	0.26
82_D	85_K	0.593	0.26
21_R	77_S	0.589	0.25
73_A	79_T	0.586	0.25
9_R	94_L	0.585	0.25
71_G	74_Y	0.571	0.24
19_S	77_S	0.569	0.24
40_D	43_V	0.566	0.24
6_K	17_R	0.559	0.24
18_K	55_P	0.559	0.24
75_L	80_L	0.555	0.23
29_L	36_Y	0.540	0.23
53_G	61_G	0.539	0.23
37_K	87_I	0.538	0.23
13_R	53_G	0.537	0.22
50_V	72_R	0.534	0.22
14_S	87_I	0.534	0.22
24_G	77_S	0.529	0.22
7_G	13_R	0.527	0.22
82_D	89_V	0.526	0.22
75_L	86_V	0.525	0.22
72_R	79_T	0.522	0.22
9_R	13_R	0.521	0.22
62_K	65_K	0.510	0.21
67_I	76_V	0.509	0.21
37_K	77_S	0.507	0.21
5_S	87_I	0.501	0.21
8_Y	79_T	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1vx7V	1	0.9604	100	0.064	Contact Map
3zf7U	1	0.9703	100	0.067	Contact Map
3j61T	1	0.9802	100	0.071	Contact Map
3j21R	1	0.9406	100	0.073	Contact Map
4ujrG	1	0.9703	100	0.077	Contact Map
3jywQ	1	0.9703	100	0.077	Contact Map
4a17P	1	0.9703	100	0.078	Contact Map
1vq8Q	1	0.9406	100	0.08	Contact Map
4w20T	1	0.9703	100	0.082	Contact Map
4w20Y	1	0.8812	63.9	0.91	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.