RS3A - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS3A - 30S ribosomal protein S3Ae

UniProt:	Q9UXD4	Sequences: MSAKGGAIKDKWKMKKWYSVITPKAFGEVSLGSTPAYDITQTIGRRVETTLYDLTGDFSQVYVHLYFKIIGNEGDRLITRFVGHELSRDYLRSLIRRKSSKINSIFDVTTKDGYVVRVKGLVLTTYKCHQSQKTAIRKIINETVSKKASELSFDDFTQEVVFGRLANEIFEAAKKIYPLRKAEIEKTKVLKVPENLGKQVESSSVSSG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	208 (193)
Sequences:	462 (290)
Seq/√Len:	20.9

HALSA - RS3A
SULSO - RS3A

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
88_R	92_R	6.878	1.00
69_I	77_L	3.860	1.00
14_M	37_Y	3.296	1.00
118_V	144_V	3.173	1.00
84_H	187_T	2.995	0.99
37_Y	41_Q	2.858	0.99
116_V	156_F	2.499	0.98
167_N	170_F	2.471	0.97
47_V	69_I	2.471	0.97
160_V	187_T	2.453	0.97
156_F	160_V	2.452	0.97
19_S	30_S	2.447	0.97
119_K	188_K	2.434	0.97
9_K	12_W	2.376	0.97
118_V	156_F	2.360	0.97
92_R	95_I	2.312	0.96
124_T	128_C	2.298	0.96
57_D	60_Q	2.169	0.95
19_S	33_S	2.082	0.93
140_I	169_I	2.044	0.93
45_R	137_R	2.007	0.92
45_R	112_D	1.992	0.92
168_E	172_A	1.986	0.91
148_A	156_F	1.863	0.89
128_C	132_Q	1.749	0.85
68_K	82_V	1.747	0.85
45_R	117_R	1.724	0.84
114_Y	193_P	1.688	0.83
57_D	182_A	1.685	0.83
6_G	35_P	1.676	0.83
9_K	96_R	1.641	0.81
156_F	163_G	1.620	0.80
117_R	137_R	1.559	0.78
68_K	192_V	1.552	0.77
120_G	184_I	1.529	0.76
65_L	156_F	1.514	0.75
111_K	152_S	1.506	0.75
94_L	99_S	1.505	0.75
91_L	121_L	1.497	0.75
19_S	42_T	1.475	0.74
5_G	8_I	1.466	0.73
130_Q	134_T	1.422	0.71
52_Y	133_K	1.417	0.70
152_S	155_D	1.409	0.70
92_R	150_E	1.387	0.69
138_K	141_N	1.378	0.68
15_K	23_P	1.362	0.67
109_T	115_V	1.344	0.66
138_K	142_E	1.342	0.66
121_L	133_K	1.326	0.65
165_L	184_I	1.303	0.64
39_I	77_L	1.295	0.63
68_K	133_K	1.293	0.63
128_C	133_K	1.289	0.63
112_D	137_R	1.278	0.62
86_L	183_E	1.269	0.62
120_G	140_I	1.259	0.61
147_K	159_E	1.254	0.61
40_T	43_I	1.247	0.60
41_Q	77_L	1.238	0.60
10_D	20_V	1.218	0.58
132_Q	169_I	1.199	0.57
68_K	100_S	1.193	0.57
61_V	96_R	1.181	0.56
68_K	92_R	1.180	0.56
189_V	192_V	1.173	0.55
140_I	144_V	1.172	0.55
65_L	160_V	1.164	0.55
22_T	44_G	1.163	0.55
142_E	147_K	1.152	0.54
104_S	141_N	1.151	0.54
39_I	126_Y	1.124	0.52
34_T	114_Y	1.122	0.52
20_V	31_L	1.115	0.52
119_K	185_E	1.109	0.51
72_N	77_L	1.104	0.51
170_F	181_K	1.099	0.51
31_L	173_A	1.086	0.50
120_G	144_V	1.086	0.50
100_S	133_K	1.074	0.49
34_T	42_T	1.066	0.48
112_D	117_R	1.064	0.48
136_I	140_I	1.062	0.48
55_T	59_S	1.050	0.47
47_V	177_Y	1.037	0.46
84_H	160_V	1.026	0.46
110_T	114_Y	1.020	0.45
85_E	106_F	1.015	0.45
45_R	69_I	1.010	0.45
140_I	182_A	1.009	0.45
50_T	62_Y	1.006	0.44
132_Q	136_I	1.005	0.44
163_G	181_K	1.003	0.44
192_V	195_N	0.996	0.44
139_I	142_E	0.994	0.44
38_D	46_R	0.983	0.43
35_P	175_K	0.973	0.42
107_D	113_G	0.970	0.42
48_E	64_H	0.965	0.42
26_F	51_L	0.958	0.41
103_N	185_E	0.955	0.41
96_R	152_S	0.949	0.41
18_Y	128_C	0.944	0.40
86_L	151_L	0.934	0.40
69_I	118_V	0.929	0.39
51_L	123_L	0.926	0.39
18_Y	39_I	0.921	0.39
94_L	163_G	0.915	0.39
123_L	185_E	0.914	0.39
53_D	117_R	0.908	0.38
72_N	76_R	0.903	0.38
63_V	84_H	0.902	0.38
116_V	131_S	0.902	0.38
32_G	36_A	0.895	0.37
35_P	68_K	0.892	0.37
59_S	163_G	0.883	0.37
65_L	163_G	0.881	0.36
20_V	158_Q	0.880	0.36
24_K	28_E	0.877	0.36
36_A	39_I	0.865	0.36
118_V	148_A	0.862	0.35
67_F	193_P	0.860	0.35
144_V	172_A	0.859	0.35
54_L	71_G	0.856	0.35
69_I	180_R	0.854	0.35
31_L	86_L	0.853	0.35
47_V	54_L	0.850	0.35
47_V	173_A	0.849	0.35
18_Y	178_P	0.846	0.34
21_I	30_S	0.846	0.34
39_I	72_N	0.844	0.34
7_A	46_R	0.840	0.34
68_K	96_R	0.840	0.34
166_A	179_L	0.838	0.34
5_G	144_V	0.837	0.34
122_V	179_L	0.833	0.34
51_L	94_L	0.822	0.33
48_E	93_S	0.821	0.33
61_V	99_S	0.818	0.33
82_V	160_V	0.817	0.33
88_R	93_S	0.817	0.33
52_Y	55_T	0.815	0.33
91_L	176_I	0.815	0.33
50_T	80_R	0.810	0.32
57_D	174_K	0.807	0.32
168_E	171_E	0.805	0.32
54_L	118_V	0.803	0.32
100_S	142_E	0.800	0.32
115_V	161_V	0.796	0.31
53_D	76_R	0.794	0.31
48_E	177_Y	0.794	0.31
143_T	169_I	0.791	0.31
9_K	13_K	0.789	0.31
29_V	36_A	0.781	0.31
141_N	145_S	0.777	0.30
12_W	35_P	0.772	0.30
158_Q	169_I	0.771	0.30
128_C	177_Y	0.766	0.30
90_Y	183_E	0.765	0.30
41_Q	179_L	0.764	0.30
19_S	75_D	0.761	0.29
40_T	70_I	0.757	0.29
98_K	119_K	0.752	0.29
187_T	191_K	0.751	0.29
104_S	179_L	0.750	0.29
20_V	180_R	0.748	0.29
99_S	123_L	0.747	0.29
26_F	32_G	0.743	0.28
83_G	137_R	0.742	0.28
67_F	133_K	0.737	0.28
13_K	111_K	0.733	0.28
159_E	164_R	0.730	0.28
103_N	123_L	0.725	0.28
60_Q	188_K	0.724	0.27
72_N	95_I	0.723	0.27
167_N	173_A	0.723	0.27
17_W	23_P	0.720	0.27
142_E	146_K	0.719	0.27
86_L	121_L	0.719	0.27
16_K	19_S	0.719	0.27
46_R	68_K	0.707	0.27
60_Q	103_N	0.707	0.27
11_K	119_K	0.705	0.26
32_G	169_I	0.705	0.26
69_I	91_L	0.704	0.26
88_R	141_N	0.704	0.26
64_H	160_V	0.700	0.26
24_K	190_L	0.693	0.26
139_I	144_V	0.686	0.26
105_I	118_V	0.684	0.25
33_S	170_F	0.682	0.25
113_G	152_S	0.682	0.25
81_F	89_D	0.678	0.25
67_F	79_T	0.677	0.25
169_I	185_E	0.675	0.25
26_F	34_T	0.669	0.25
64_H	87_S	0.669	0.25
148_A	151_L	0.668	0.25
50_T	77_L	0.668	0.25
41_Q	46_R	0.663	0.24
76_R	155_D	0.663	0.24
156_F	168_E	0.661	0.24
67_F	105_I	0.660	0.24
20_V	79_T	0.656	0.24
109_T	159_E	0.656	0.24
113_G	117_R	0.655	0.24
115_V	190_L	0.655	0.24
91_L	169_I	0.655	0.24
39_I	43_I	0.653	0.24
42_T	66_Y	0.653	0.24
116_V	146_K	0.650	0.24
108_V	148_A	0.649	0.24
73_E	76_R	0.646	0.24
153_F	189_V	0.635	0.23
122_V	144_V	0.631	0.23
41_Q	154_D	0.631	0.23
113_G	133_K	0.630	0.23
90_Y	97_R	0.629	0.23
17_W	137_R	0.627	0.23
117_R	189_V	0.626	0.23
54_L	82_V	0.625	0.23
171_E	186_K	0.623	0.22
75_D	118_V	0.622	0.22
98_K	101_K	0.621	0.22
8_I	155_D	0.619	0.22
166_A	189_V	0.617	0.22
35_P	149_S	0.616	0.22
118_V	187_T	0.612	0.22
22_T	189_V	0.609	0.22
85_E	143_T	0.605	0.22
170_F	188_K	0.601	0.21
34_T	54_L	0.587	0.21
32_G	136_I	0.586	0.21
147_K	151_L	0.584	0.21
169_I	189_V	0.584	0.21
18_Y	74_G	0.582	0.21
66_Y	149_S	0.581	0.21
115_V	142_E	0.581	0.21
180_R	183_E	0.578	0.20
184_I	193_P	0.577	0.20
35_P	61_V	0.576	0.20
89_D	186_K	0.576	0.20
20_V	24_K	0.575	0.20
27_G	105_I	0.573	0.20
111_K	115_V	0.566	0.20
18_Y	45_R	0.565	0.20
65_L	116_V	0.564	0.20
107_D	190_L	0.564	0.20
53_D	73_E	0.562	0.20
98_K	188_K	0.561	0.20
49_T	109_T	0.555	0.19
143_T	184_I	0.552	0.19
51_L	114_Y	0.552	0.19
123_L	180_R	0.547	0.19
27_G	167_N	0.545	0.19
96_R	102_I	0.543	0.19
47_V	194_E	0.542	0.19
157_T	197_G	0.541	0.19
101_K	121_L	0.541	0.19
9_K	197_G	0.540	0.19
115_V	189_V	0.539	0.19
33_S	36_A	0.536	0.19
29_V	149_S	0.535	0.19
132_Q	135_A	0.535	0.19
120_G	188_K	0.534	0.19
116_V	136_I	0.533	0.19
8_I	152_S	0.530	0.18
52_Y	103_N	0.526	0.18
138_K	184_I	0.523	0.18
40_T	138_K	0.523	0.18
117_R	127_K	0.522	0.18
143_T	165_L	0.521	0.18
129_H	134_T	0.520	0.18
46_R	146_K	0.520	0.18
57_D	132_Q	0.517	0.18
116_V	160_V	0.517	0.18
91_L	157_T	0.514	0.18
24_K	75_D	0.512	0.18
95_I	128_C	0.510	0.18
52_Y	128_C	0.510	0.18
69_I	174_K	0.510	0.18
51_L	183_E	0.508	0.18
58_F	184_I	0.508	0.18
118_V	149_S	0.508	0.18
163_G	168_E	0.506	0.18
62_Y	129_H	0.504	0.17
102_I	124_T	0.503	0.17
95_I	150_E	0.502	0.17
64_H	126_Y	0.501	0.17
13_K	97_R	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j7aB	1	0.9327	100	0.017	Contact Map
3j60B	1	0.9375	100	0.019	Contact Map
3j38B	1	0.9663	100	0.02	Contact Map
4ujpC	1	0.9519	100	0.022	Contact Map
3zey0	1	0.9615	100	0.025	Contact Map
4w23B	1	0.9471	100	0.027	Contact Map
4bpe4	1	0.9087	100	0.029	Contact Map
3j20A	1	0.9135	100	0.045	Contact Map
4fvgA	2	0.4663	14.2	0.963	Contact Map
3bk6A	3	0.5673	9.8	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.008 seconds.