RL15E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL15E - 50S ribosomal protein L15e

UniProt:	Q9UXD0	Sequences: MALSMYHYIENTWNSEEWKKSVLRQRLIKWRKEPSIVRLAKPTRLNRARSLGYKAKQGFVIVRVRVRRGGLNKPRPNKGRRPKRMGVYGYSPAKGYRWIAEERAARKYPNLEVLGSYYVGEDGLYKYYEIVMVDPSHPVIKSDPKHKWLQDPSNRNRVFRGLTSAGKKVRGLRKSRGLKGTVRYKWNRKQKEREEKKRHEASKYYKLQEYDKIPGK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	216 (190)
Sequences:	340 (188)
Seq/√Len:	13.6

HALSA - RL15E
SULSO - RL15E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_F	146_H	4.400	1.00
138_P	142_S	4.179	1.00
81_R	84_R	3.784	0.99
62_V	108_Y	3.366	0.99
15_S	174_K	2.976	0.97
36_I	64_V	2.857	0.96
110_N	136_S	2.822	0.96
73_K	167_K	2.560	0.93
57_Q	137_H	2.460	0.91
4_S	7_H	2.386	0.90
66_V	128_Y	2.331	0.89
178_L	181_T	2.289	0.88
3_L	7_H	2.235	0.86
143_D	146_H	2.220	0.86
9_I	45_L	2.211	0.86
60_V	111_L	2.203	0.86
46_N	154_N	2.183	0.85
92_P	99_I	2.103	0.83
27_L	120_G	2.093	0.83
105_A	158_V	2.064	0.82
51_L	115_G	1.962	0.78
70_G	90_Y	1.925	0.77
75_R	87_V	1.904	0.76
175_S	180_G	1.850	0.74
143_D	147_K	1.815	0.72
68_R	71_L	1.813	0.72
176_R	180_G	1.812	0.72
163_T	170_R	1.750	0.69
44_R	63_R	1.734	0.69
64_V	104_A	1.729	0.68
83_K	95_G	1.708	0.67
115_G	149_L	1.680	0.66
56_K	143_D	1.675	0.66
176_R	181_T	1.644	0.64
147_K	150_Q	1.636	0.64
57_Q	139_V	1.628	0.64
83_K	187_N	1.580	0.61
96_Y	128_Y	1.565	0.60
105_A	159_F	1.562	0.60
29_K	34_P	1.554	0.60
12_T	19_K	1.520	0.58
29_K	142_S	1.486	0.56
92_P	98_W	1.483	0.56
21_S	25_Q	1.482	0.56
128_Y	168_K	1.462	0.55
98_W	102_E	1.440	0.54
173_R	181_T	1.435	0.54
97_R	145_K	1.402	0.52
44_R	67_R	1.401	0.52
35_S	43_T	1.395	0.51
66_V	113_V	1.391	0.51
4_S	11_N	1.390	0.51
26_R	43_T	1.370	0.50
102_E	166_G	1.356	0.49
113_V	132_M	1.347	0.49
42_P	55_A	1.344	0.49
10_E	14_N	1.343	0.49
13_W	44_R	1.332	0.48
176_R	179_K	1.329	0.48
98_W	169_V	1.323	0.48
88_Y	95_G	1.307	0.47
31_R	170_R	1.301	0.46
26_R	31_R	1.292	0.46
107_K	162_L	1.288	0.46
47_R	152_P	1.281	0.45
19_K	47_R	1.280	0.45
120_G	127_Y	1.239	0.43
172_L	179_K	1.233	0.43
179_K	182_V	1.213	0.42
178_L	185_K	1.200	0.41
60_V	108_Y	1.193	0.41
38_R	87_V	1.191	0.41
133_V	146_H	1.184	0.40
33_E	37_V	1.134	0.38
88_Y	103_R	1.131	0.38
13_W	84_R	1.114	0.37
110_N	120_G	1.105	0.36
14_N	130_I	1.103	0.36
61_I	108_Y	1.103	0.36
26_R	170_R	1.103	0.36
13_W	120_G	1.075	0.35
169_V	181_T	1.069	0.35
97_R	165_A	1.069	0.35
182_V	185_K	1.045	0.33
153_S	162_L	1.043	0.33
35_S	65_R	1.032	0.33
120_G	147_K	1.026	0.32
97_R	182_V	1.025	0.32
40_A	110_N	1.022	0.32
94_K	102_E	1.009	0.32
10_E	145_K	0.985	0.31
47_R	50_S	0.983	0.30
66_V	187_N	0.979	0.30
106_R	145_K	0.973	0.30
24_R	28_I	0.968	0.30
185_K	189_K	0.966	0.30
126_K	170_R	0.965	0.30
180_G	185_K	0.957	0.29
20_K	133_V	0.951	0.29
83_K	93_A	0.946	0.29
24_R	65_R	0.943	0.29
121_E	126_K	0.943	0.29
14_N	46_N	0.926	0.28
24_R	38_R	0.922	0.28
95_G	172_L	0.920	0.28
175_S	179_K	0.919	0.28
4_S	72_N	0.912	0.27
132_M	166_G	0.906	0.27
97_R	164_S	0.905	0.27
80_R	87_V	0.903	0.27
79_G	84_R	0.899	0.27
11_N	137_H	0.890	0.26
115_G	132_M	0.889	0.26
139_V	142_S	0.878	0.26
16_E	127_Y	0.877	0.26
98_W	158_V	0.874	0.26
80_R	123_G	0.867	0.26
76_P	125_Y	0.862	0.25
72_N	78_K	0.861	0.25
29_K	33_E	0.854	0.25
5_M	29_K	0.851	0.25
112_E	158_V	0.843	0.25
36_I	142_S	0.836	0.24
98_W	166_G	0.831	0.24
36_I	84_R	0.821	0.24
85_M	106_R	0.820	0.24
47_R	51_L	0.820	0.24
120_G	165_A	0.818	0.24
56_K	59_F	0.810	0.23
34_P	81_R	0.808	0.23
46_N	96_Y	0.808	0.23
151_D	154_N	0.804	0.23
31_R	160_R	0.797	0.23
109_P	156_N	0.793	0.23
29_K	182_V	0.790	0.22
48_A	129_E	0.787	0.22
108_Y	127_Y	0.779	0.22
178_L	184_Y	0.778	0.22
115_G	131_V	0.777	0.22
31_R	68_R	0.771	0.22
164_S	173_R	0.770	0.22
121_E	133_V	0.766	0.22
9_I	66_V	0.764	0.22
104_A	108_Y	0.762	0.21
11_N	14_N	0.757	0.21
44_R	68_R	0.756	0.21
163_T	171_G	0.755	0.21
97_R	185_K	0.752	0.21
6_Y	99_I	0.752	0.21
99_I	176_R	0.749	0.21
107_K	169_V	0.744	0.21
44_R	160_R	0.740	0.21
37_V	45_L	0.738	0.21
121_E	140_I	0.737	0.21
19_K	186_W	0.734	0.20
175_S	178_L	0.734	0.20
125_Y	149_L	0.730	0.20
66_V	165_A	0.730	0.20
111_L	188_R	0.728	0.20
12_T	139_V	0.726	0.20
17_E	32_K	0.724	0.20
45_L	109_P	0.718	0.20
126_K	156_N	0.717	0.20
150_Q	180_G	0.715	0.20
5_M	23_L	0.710	0.20
137_H	144_P	0.709	0.20
40_A	127_Y	0.709	0.20
23_L	121_E	0.702	0.19
27_L	128_Y	0.698	0.19
71_L	92_P	0.697	0.19
79_G	178_L	0.696	0.19
3_L	91_S	0.695	0.19
37_V	104_A	0.694	0.19
89_G	181_T	0.694	0.19
161_G	170_R	0.693	0.19
80_R	89_G	0.692	0.19
110_N	133_V	0.691	0.19
9_I	145_K	0.689	0.19
34_P	80_R	0.689	0.19
43_T	183_R	0.687	0.19
48_A	157_R	0.685	0.19
64_V	125_Y	0.681	0.19
43_T	123_G	0.680	0.19
157_R	170_R	0.679	0.19
111_L	132_M	0.678	0.19
74_P	93_A	0.677	0.19
24_R	60_V	0.676	0.19
65_R	168_K	0.673	0.18
88_Y	102_E	0.671	0.18
180_G	187_N	0.670	0.18
118_Y	176_R	0.670	0.18
110_N	179_K	0.667	0.18
181_T	184_Y	0.664	0.18
63_R	68_R	0.664	0.18
79_G	83_K	0.662	0.18
68_R	111_L	0.661	0.18
143_D	183_R	0.658	0.18
41_K	106_R	0.655	0.18
13_W	166_G	0.654	0.18
16_E	21_S	0.649	0.18
139_V	151_D	0.649	0.18
120_G	136_S	0.649	0.18
70_G	74_P	0.648	0.18
5_M	17_E	0.648	0.18
164_S	189_K	0.637	0.17
64_V	127_Y	0.636	0.17
142_S	182_V	0.634	0.17
107_K	146_H	0.626	0.17
33_E	127_Y	0.625	0.17
22_V	72_N	0.625	0.17
27_L	123_G	0.625	0.17
3_L	78_K	0.623	0.17
75_R	123_G	0.622	0.17
39_L	191_K	0.621	0.17
44_R	83_K	0.618	0.17
112_E	155_R	0.618	0.17
26_R	160_R	0.615	0.17
83_K	173_R	0.612	0.17
45_L	175_S	0.612	0.17
28_I	82_P	0.611	0.17
8_Y	23_L	0.607	0.16
105_A	112_E	0.607	0.16
6_Y	44_R	0.607	0.16
41_K	71_L	0.601	0.16
79_G	159_F	0.601	0.16
121_E	125_Y	0.601	0.16
38_R	128_Y	0.601	0.16
38_R	148_W	0.599	0.16
62_V	111_L	0.596	0.16
7_H	187_N	0.595	0.16
3_L	72_N	0.594	0.16
57_Q	144_P	0.592	0.16
103_R	160_R	0.590	0.16
86_G	188_R	0.587	0.16
57_Q	142_S	0.586	0.16
140_I	177_G	0.583	0.16
75_R	78_K	0.581	0.16
31_R	44_R	0.580	0.16
59_F	155_R	0.568	0.15
80_R	85_M	0.566	0.15
46_N	98_W	0.563	0.15
97_R	173_R	0.560	0.15
154_N	176_R	0.559	0.15
26_R	67_R	0.555	0.15
70_G	89_G	0.554	0.15
122_D	148_W	0.554	0.15
138_P	178_L	0.552	0.15
7_H	34_P	0.551	0.15
31_R	157_R	0.550	0.15
143_D	150_Q	0.550	0.15
119_V	128_Y	0.549	0.15
17_E	24_R	0.545	0.15
63_R	118_Y	0.544	0.15
43_T	119_V	0.541	0.15
73_K	135_P	0.540	0.15
13_W	168_K	0.539	0.15
9_I	192_E	0.539	0.15
15_S	33_E	0.538	0.14
181_T	185_K	0.536	0.14
123_G	138_P	0.530	0.14
154_N	162_L	0.530	0.14
5_M	47_R	0.528	0.14
4_S	55_A	0.528	0.14
3_L	82_P	0.527	0.14
78_K	155_R	0.524	0.14
109_P	136_S	0.524	0.14
35_S	64_V	0.522	0.14
104_A	132_M	0.520	0.14
13_W	164_S	0.518	0.14
42_P	69_G	0.518	0.14
12_T	18_W	0.518	0.14
44_R	148_W	0.517	0.14
31_R	122_D	0.517	0.14
70_G	165_A	0.513	0.14
105_A	125_Y	0.513	0.14
24_R	156_N	0.512	0.14
173_R	178_L	0.511	0.14
50_S	89_G	0.511	0.14
97_R	191_K	0.508	0.14
169_V	173_R	0.508	0.14
58_G	117_Y	0.506	0.14
76_P	178_L	0.502	0.14
76_P	79_G	0.501	0.14
65_R	93_A	0.501	0.14
107_K	121_E	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zf7Q	1	0.9028	100	0.128	Contact Map
3j39N	1	0.9028	100	0.129	Contact Map
4a17L	1	0.9028	100	0.138	Contact Map
4ujrA	1	0.9074	100	0.139	Contact Map
1vx7P	1	0.9028	100	0.141	Contact Map
3j61N	1	0.8611	100	0.15	Contact Map
1vq8M	1	0.8889	100	0.172	Contact Map
3j21M	1	0.8889	100	0.176	Contact Map
1ffkI	1	0.8889	100	0.186	Contact Map
4tp8P	1	0.3472	5.7	0.979	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.