BRIX - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BRIX - Probable Brix domain-containing ribosomal biogenesis protein

UniProt:	Q9UXB9	Sequences: MHIHRTRIVITSSRDPSIRTRNFLNVLTFVLPDSVKITRGKKSKIEIFERAINLGALYLLFVLAKNGNPLRIIVYDLESLSIKYFFKLSGLSLPSDYNVSLNQIKGHSNVCIKLNECDFLRDFLVDMNMYNLTNNCDVVVNSRLIHTNICELLFMLTTKNIKFLKMILEA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	170 (153)
Sequences:	611 (325)
Seq/√Len:	26.2

SULSO - BRIX

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_Y	123_F	4.031	1.00
141_N	144_L	3.834	1.00
141_N	155_M	3.688	1.00
30_V	152_L	3.672	1.00
10_I	27_L	3.466	1.00
8_I	31_L	3.015	1.00
58_Y	76_D	2.945	1.00
10_I	34_S	2.870	1.00
27_L	62_V	2.635	0.99
138_V	154_F	2.403	0.99
48_F	59_L	2.237	0.98
100_S	103_Q	2.132	0.97
101_L	104_I	2.120	0.97
8_I	60_L	1.978	0.95
60_L	74_V	1.935	0.95
145_I	148_N	1.916	0.94
14_R	17_S	1.883	0.94
65_K	70_L	1.862	0.93
104_I	107_H	1.854	0.93
113_K	121_R	1.850	0.93
24_L	62_V	1.808	0.92
71_R	85_F	1.781	0.92
9_V	56_A	1.760	0.91
20_T	62_V	1.758	0.91
108_S	129_M	1.691	0.90
62_V	72_I	1.600	0.87
19_R	22_N	1.579	0.86
20_T	69_P	1.578	0.86
17_S	40_G	1.530	0.84
114_L	144_L	1.529	0.84
78_E	82_I	1.529	0.84
26_V	69_P	1.502	0.83
50_R	53_N	1.482	0.82
124_L	143_R	1.449	0.81
112_I	141_N	1.390	0.78
146_H	149_I	1.386	0.78
111_C	129_M	1.344	0.75
43_S	46_E	1.321	0.74
136_C	139_V	1.314	0.74
9_V	51_A	1.309	0.73
27_L	160_N	1.300	0.73
114_L	146_H	1.291	0.72
143_R	150_C	1.281	0.72
32_P	129_M	1.279	0.72
14_R	40_G	1.275	0.71
26_V	96_D	1.253	0.70
121_R	125_V	1.248	0.70
93_L	96_D	1.247	0.70
60_L	72_I	1.240	0.69
69_P	88_L	1.240	0.69
78_E	81_S	1.225	0.68
35_V	56_A	1.224	0.68
74_V	127_M	1.171	0.65
51_A	56_A	1.162	0.64
10_I	60_L	1.158	0.64
74_V	123_F	1.154	0.64
122_D	126_D	1.144	0.63
113_K	143_R	1.142	0.63
26_V	93_L	1.110	0.61
49_E	55_G	1.100	0.60
122_D	125_V	1.079	0.58
31_L	107_H	1.067	0.57
78_E	86_F	1.064	0.57
7_R	55_G	1.054	0.56
27_L	108_S	1.047	0.56
7_R	35_V	1.030	0.55
147_T	151_E	1.012	0.53
8_I	30_V	0.984	0.51
19_R	68_N	0.984	0.51
17_S	88_L	0.979	0.51
16_P	20_T	0.979	0.51
122_D	146_H	0.970	0.50
81_S	109_N	0.961	0.50
141_N	146_H	0.959	0.49
148_N	153_L	0.958	0.49
61_F	68_N	0.953	0.49
68_N	91_L	0.950	0.49
15_D	96_D	0.942	0.48
137_D	155_M	0.940	0.48
88_L	91_L	0.934	0.48
66_N	69_P	0.932	0.47
37_I	47_I	0.922	0.47
119_F	122_D	0.918	0.46
16_P	40_G	0.910	0.46
146_H	151_E	0.907	0.46
137_D	152_L	0.907	0.46
125_V	131_N	0.906	0.46
20_T	25_N	0.900	0.45
42_K	97_Y	0.899	0.45
37_I	56_A	0.895	0.45
12_S	24_L	0.892	0.44
92_S	96_D	0.891	0.44
48_F	77_L	0.883	0.44
97_Y	100_S	0.883	0.44
15_D	18_I	0.871	0.43
132_L	136_C	0.871	0.43
74_V	86_F	0.870	0.43
81_S	153_L	0.865	0.43
23_F	40_G	0.859	0.42
32_P	120_L	0.855	0.42
153_L	157_T	0.855	0.42
63_L	70_L	0.851	0.42
54_L	135_N	0.849	0.41
54_L	93_L	0.843	0.41
97_Y	101_L	0.843	0.41
87_K	101_L	0.836	0.40
43_S	59_L	0.832	0.40
134_N	151_E	0.832	0.40
34_S	37_I	0.826	0.40
101_L	158_T	0.823	0.40
95_S	123_F	0.815	0.39
7_R	30_V	0.814	0.39
144_L	151_E	0.812	0.39
10_I	107_H	0.805	0.38
47_I	67_G	0.800	0.38
8_I	68_N	0.792	0.37
120_L	128_N	0.792	0.37
76_D	82_I	0.791	0.37
18_I	25_N	0.785	0.37
59_L	127_M	0.785	0.37
141_N	148_N	0.783	0.37
121_R	144_L	0.782	0.37
81_S	116_E	0.764	0.35
62_V	118_D	0.763	0.35
33_D	55_G	0.763	0.35
102_N	140_V	0.757	0.35
147_T	156_L	0.753	0.35
109_N	116_E	0.750	0.34
18_I	21_R	0.747	0.34
82_I	153_L	0.745	0.34
22_N	43_S	0.742	0.34
74_V	93_L	0.741	0.34
108_S	130_Y	0.740	0.34
110_V	116_E	0.737	0.34
29_F	154_F	0.734	0.33
73_I	83_K	0.734	0.33
14_R	41_K	0.733	0.33
27_L	127_M	0.732	0.33
79_S	140_V	0.724	0.33
135_N	138_V	0.722	0.33
88_L	117_C	0.722	0.33
137_D	153_L	0.719	0.32
17_S	20_T	0.718	0.32
49_E	52_I	0.714	0.32
24_L	27_L	0.713	0.32
65_K	116_E	0.709	0.32
74_V	124_L	0.703	0.31
38_T	67_G	0.699	0.31
8_I	33_D	0.693	0.31
79_S	93_L	0.691	0.31
97_Y	102_N	0.690	0.31
14_R	38_T	0.686	0.30
148_N	157_T	0.682	0.30
78_E	83_K	0.675	0.30
52_I	79_S	0.670	0.29
97_Y	104_I	0.668	0.29
126_D	133_T	0.659	0.29
89_S	121_R	0.656	0.28
9_V	43_S	0.649	0.28
42_K	133_T	0.649	0.28
20_T	64_A	0.648	0.28
100_S	104_I	0.647	0.28
30_V	140_V	0.644	0.28
10_I	45_I	0.643	0.28
8_I	94_P	0.642	0.28
151_E	157_T	0.638	0.27
7_R	56_A	0.637	0.27
52_I	55_G	0.632	0.27
50_R	54_L	0.628	0.27
24_L	87_K	0.626	0.27
42_K	50_R	0.625	0.27
48_F	71_R	0.620	0.26
73_I	154_F	0.617	0.26
107_H	136_C	0.607	0.26
35_V	72_I	0.607	0.26
32_P	155_M	0.606	0.26
58_Y	126_D	0.605	0.25
20_T	95_S	0.605	0.25
10_I	24_L	0.603	0.25
33_D	152_L	0.602	0.25
150_C	153_L	0.601	0.25
50_R	101_L	0.599	0.25
46_E	101_L	0.598	0.25
110_V	159_K	0.591	0.25
93_L	103_Q	0.591	0.25
149_I	157_T	0.591	0.25
47_I	59_L	0.590	0.25
51_A	159_K	0.586	0.24
48_F	52_I	0.582	0.24
25_N	67_G	0.580	0.24
47_I	156_L	0.580	0.24
61_F	122_D	0.578	0.24
14_R	19_R	0.578	0.24
58_Y	127_M	0.576	0.24
31_L	44_K	0.572	0.24
34_S	40_G	0.570	0.24
13_S	69_P	0.569	0.23
41_K	50_R	0.568	0.23
70_L	152_L	0.563	0.23
99_V	103_Q	0.560	0.23
110_V	134_N	0.560	0.23
77_L	114_L	0.558	0.23
82_I	109_N	0.556	0.23
101_L	141_N	0.555	0.23
62_V	69_P	0.555	0.23
52_I	77_L	0.553	0.23
151_E	156_L	0.552	0.23
110_V	113_K	0.549	0.22
57_L	131_N	0.542	0.22
33_D	57_L	0.540	0.22
50_R	87_K	0.538	0.22
33_D	45_I	0.533	0.22
5_R	131_N	0.532	0.22
42_K	54_L	0.530	0.21
61_F	95_S	0.528	0.21
117_C	160_N	0.527	0.21
21_R	38_T	0.523	0.21
52_I	158_T	0.523	0.21
139_V	157_T	0.523	0.21
42_K	56_A	0.523	0.21
30_V	139_V	0.521	0.21
7_R	57_L	0.521	0.21
16_P	25_N	0.521	0.21
85_F	108_S	0.519	0.21
10_I	35_V	0.510	0.20
77_L	82_I	0.506	0.20
36_K	88_L	0.506	0.20
14_R	94_P	0.504	0.20
13_S	37_I	0.501	0.20
5_R	126_D	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w94A	1	0.8529	100	0.378	Contact Map
2cxhA	1	0.9471	100	0.379	Contact Map
5by8A	1	0.9706	100	0.5	Contact Map
4xd9A	1	0.9765	100	0.516	Contact Map
1h4vB	2	0.5706	33	0.945	Contact Map
1httA	2	0.5765	20.9	0.95	Contact Map
2lw7A	1	0.6176	20.3	0.95	Contact Map
3netA	2	0.5706	18.2	0.951	Contact Map
3iklA	2	0.6	17.3	0.952	Contact Map
4hwtA	2	0.6235	16.7	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.