PFDB - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PFDB - Prefoldin subunit beta

UniProt:	Q9UXB8	Sequences: MAEKLPPEVQAQLAKFQQLKDQLDRLLLEKSTIENELREINKVLEELSVLNADATIYKIVGNLLVKSDKTSVEKELNDRKELLELRSRTYQKQESILRKQLEDLQAKINDMLSKYYPQGGQTGIKA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	126 (113)
Sequences:	178 (132)
Seq/√Len:	12.4

HALSA - PFDB
SULSO - PFDB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
68_D	71_S	3.440	0.98
48_S	77_N	2.710	0.93
23_L	97_L	2.430	0.88
103_D	107_K	2.341	0.86
52_A	69_K	2.243	0.84
11_A	32_T	2.166	0.82
57_Y	87_S	1.985	0.75
85_L	99_K	1.964	0.74
41_N	80_K	1.930	0.73
26_L	73_E	1.921	0.73
15_K	95_S	1.852	0.70
6_P	100_Q	1.783	0.67
24_D	94_E	1.768	0.66
67_S	72_V	1.768	0.66
13_L	81_E	1.716	0.64
4_K	25_R	1.633	0.60
17_Q	86_R	1.631	0.60
16_F	101_L	1.571	0.57
46_E	89_T	1.531	0.55
97_L	114_K	1.520	0.54
5_L	18_Q	1.501	0.53
106_A	110_D	1.497	0.53
70_T	75_E	1.495	0.53
44_L	73_E	1.451	0.51
46_E	49_V	1.448	0.50
4_K	18_Q	1.424	0.49
70_T	74_K	1.373	0.47
42_K	45_E	1.359	0.46
88_R	92_K	1.344	0.45
54_A	110_D	1.343	0.45
10_Q	78_D	1.336	0.45
56_I	80_K	1.330	0.44
68_D	72_V	1.322	0.44
11_A	100_Q	1.318	0.44
21_D	24_D	1.315	0.44
16_F	43_V	1.313	0.44
13_L	77_N	1.310	0.43
5_L	70_T	1.309	0.43
17_Q	105_Q	1.304	0.43
75_E	89_T	1.302	0.43
44_L	76_L	1.290	0.42
8_E	107_K	1.264	0.41
13_L	37_L	1.255	0.41
107_K	111_M	1.239	0.40
5_L	74_K	1.222	0.39
48_S	73_E	1.189	0.38
37_L	64_L	1.182	0.37
29_E	86_R	1.181	0.37
15_K	66_K	1.163	0.36
28_L	85_L	1.155	0.36
26_L	90_Y	1.154	0.36
24_D	29_E	1.145	0.35
26_L	75_E	1.143	0.35
73_E	98_R	1.137	0.35
71_S	109_N	1.126	0.35
16_F	111_M	1.122	0.34
55_T	66_K	1.117	0.34
58_K	103_D	1.105	0.34
91_Q	95_S	1.083	0.33
10_Q	17_Q	1.081	0.33
9_V	99_K	1.069	0.32
58_K	75_E	1.068	0.32
20_K	23_L	1.068	0.32
81_E	99_K	1.043	0.31
20_K	24_D	1.040	0.31
34_E	57_Y	1.038	0.31
43_V	96_I	1.020	0.30
12_Q	39_E	1.020	0.30
92_K	104_L	0.993	0.29
27_L	75_E	0.986	0.28
30_K	94_E	0.977	0.28
11_A	101_L	0.977	0.28
65_V	82_L	0.959	0.27
23_L	96_I	0.958	0.27
84_E	88_R	0.957	0.27
12_Q	22_Q	0.954	0.27
48_S	99_K	0.943	0.27
26_L	114_K	0.914	0.26
86_R	105_Q	0.914	0.26
51_N	63_L	0.904	0.25
29_E	100_Q	0.900	0.25
12_Q	107_K	0.898	0.25
12_Q	18_Q	0.894	0.25
39_E	93_Q	0.888	0.25
29_E	32_T	0.887	0.24
12_Q	21_D	0.869	0.24
45_E	79_R	0.867	0.24
66_K	74_K	0.846	0.23
51_N	77_N	0.843	0.23
34_E	87_S	0.837	0.23
27_L	98_R	0.823	0.22
7_P	34_E	0.823	0.22
40_I	110_D	0.817	0.22
46_E	91_Q	0.790	0.21
16_F	60_V	0.784	0.21
22_Q	89_T	0.782	0.21
65_V	72_V	0.780	0.21
59_I	81_E	0.770	0.20
32_T	38_R	0.759	0.20
36_E	87_S	0.749	0.20
45_E	77_N	0.746	0.20
15_K	89_T	0.745	0.20
50_L	53_D	0.745	0.20
40_I	43_V	0.739	0.19
45_E	82_L	0.737	0.19
16_F	55_T	0.729	0.19
46_E	58_K	0.728	0.19
20_K	94_E	0.727	0.19
39_E	106_A	0.726	0.19
56_I	79_R	0.706	0.18
30_K	92_K	0.704	0.18
85_L	89_T	0.699	0.18
46_E	66_K	0.699	0.18
44_L	57_Y	0.699	0.18
28_L	77_N	0.697	0.18
13_L	99_K	0.697	0.18
17_Q	20_K	0.693	0.18
36_E	79_R	0.688	0.18
7_P	104_L	0.676	0.17
52_A	113_S	0.670	0.17
25_R	92_K	0.668	0.17
49_V	56_I	0.664	0.17
73_E	116_Y	0.664	0.17
7_P	16_F	0.660	0.17
23_L	27_L	0.651	0.17
64_L	75_E	0.650	0.17
22_Q	38_R	0.649	0.17
7_P	107_K	0.648	0.17
8_E	21_D	0.643	0.16
31_S	43_V	0.639	0.16
60_V	108_I	0.629	0.16
47_L	50_L	0.629	0.16
20_K	86_R	0.629	0.16
103_D	111_M	0.627	0.16
4_K	29_E	0.626	0.16
24_D	43_V	0.609	0.16
87_S	111_M	0.609	0.16
33_I	83_L	0.607	0.15
9_V	108_I	0.592	0.15
12_Q	26_L	0.583	0.15
84_E	99_K	0.577	0.15
44_L	47_L	0.572	0.15
16_F	63_L	0.572	0.15
95_S	100_Q	0.570	0.15
88_R	99_K	0.567	0.14
16_F	104_L	0.562	0.14
23_L	98_R	0.560	0.14
9_V	109_N	0.547	0.14
50_L	106_A	0.545	0.14
30_K	43_V	0.543	0.14
30_K	78_D	0.543	0.14
38_R	41_N	0.539	0.14
16_F	79_R	0.537	0.14
4_K	56_I	0.536	0.14
9_V	28_L	0.531	0.14
9_V	110_D	0.529	0.14
11_A	96_I	0.526	0.13
97_L	116_Y	0.525	0.13
9_V	14_A	0.525	0.13
50_L	55_T	0.520	0.13
15_K	85_L	0.520	0.13
95_S	99_K	0.518	0.13
15_K	29_E	0.515	0.13
27_L	104_L	0.513	0.13
13_L	17_Q	0.512	0.13
42_K	49_V	0.509	0.13
22_Q	85_L	0.504	0.13
5_L	67_S	0.501	0.13
75_E	87_S	0.500	0.13
31_S	94_E	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zqmA	5	0.9048	99.8	0.519	Contact Map
1fxkA	2	0.8492	99.8	0.542	Contact Map
3aeiA	3	0.746	99.7	0.569	Contact Map
2zdiC	2	0.9683	99.5	0.641	Contact Map
1fxkC	2	0.873	99.2	0.691	Contact Map
4cgkA	3	0.6429	85	0.886	Contact Map
4q4gX	1	0	84.2	0.888	Contact Map
1l8dA	2	0.8254	75.7	0.897	Contact Map
4rsiA	1	0.4921	74.2	0.898	Contact Map
1deqA	1	0.9127	72.2	0.899	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.