RS19 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS19 - 30S ribosomal protein S19

UniProt:	Q9UXA3	Sequences: MSLEIPPEWKNFKYRGKSIDELLNMPMDEFIKLLPSRQRRSLKRGFTDAQRHLLEKVRKYRREGKFNKTIKTHVRNLVILPELIGLKMAVYNGKEFVEFTVTPEMIGHYLGEYSITTKKVEHGEPGLKATRSSLFLAMKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	140 (132)
Sequences:	392 (211)
Seq/√Len:	18.4

HALSA - RS19
SULSO - RS19

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_I	106_I	5.191	1.00
58_R	82_E	4.487	1.00
30_F	34_L	4.200	1.00
17_K	25_M	3.406	1.00
111_G	116_T	2.374	0.95
14_Y	35_P	2.371	0.95
53_L	110_L	2.318	0.95
34_L	38_Q	2.096	0.91
124_E	127_L	2.037	0.90
38_Q	109_Y	1.825	0.84
93_G	122_H	1.817	0.83
42_L	80_L	1.794	0.83
50_Q	76_N	1.745	0.81
28_D	31_I	1.723	0.80
117_T	128_K	1.707	0.79
20_D	23_L	1.665	0.77
44_R	75_R	1.661	0.77
108_H	111_G	1.602	0.75
133_S	139_K	1.554	0.72
65_K	70_I	1.551	0.72
8_E	11_N	1.549	0.72
18_S	21_E	1.519	0.71
128_K	137_A	1.511	0.70
69_T	89_A	1.506	0.70
132_S	136_L	1.501	0.70
31_I	91_Y	1.487	0.69
35_P	38_Q	1.454	0.67
87_K	98_E	1.440	0.66
123_G	136_L	1.419	0.65
38_Q	78_V	1.375	0.63
131_R	136_L	1.370	0.62
10_K	15_R	1.366	0.62
101_V	110_L	1.360	0.62
30_F	118_K	1.359	0.62
57_V	102_T	1.345	0.61
77_L	88_M	1.340	0.61
37_R	113_Y	1.333	0.60
37_R	112_E	1.324	0.60
42_L	50_Q	1.307	0.59
131_R	134_L	1.306	0.59
54_L	82_E	1.275	0.57
42_L	71_K	1.263	0.56
128_K	132_S	1.257	0.56
109_Y	112_E	1.203	0.52
46_F	110_L	1.188	0.51
79_I	88_M	1.179	0.51
130_T	133_S	1.172	0.50
11_N	117_T	1.168	0.50
36_S	47_T	1.156	0.49
109_Y	115_I	1.155	0.49
49_A	67_N	1.151	0.49
108_H	113_Y	1.145	0.49
25_M	35_P	1.144	0.49
9_W	117_T	1.141	0.48
30_F	88_M	1.132	0.48
75_R	93_G	1.110	0.46
46_F	77_L	1.104	0.46
61_R	86_L	1.095	0.46
16_G	105_M	1.083	0.45
33_L	38_Q	1.079	0.45
83_L	136_L	1.038	0.42
110_L	118_K	1.036	0.42
9_W	137_A	1.017	0.41
57_V	74_V	1.014	0.41
27_M	35_P	1.007	0.40
127_L	133_S	0.998	0.40
36_S	42_L	0.995	0.39
100_T	117_T	0.991	0.39
84_I	101_V	0.984	0.39
25_M	106_I	0.982	0.39
130_T	135_F	0.977	0.38
40_R	75_R	0.974	0.38
89_A	98_E	0.964	0.38
70_I	114_S	0.948	0.37
16_G	112_E	0.945	0.37
92_N	114_S	0.934	0.36
117_T	124_E	0.929	0.36
113_Y	130_T	0.927	0.35
39_R	91_Y	0.927	0.35
63_E	88_M	0.927	0.35
54_L	77_L	0.925	0.35
25_M	29_E	0.924	0.35
59_K	77_L	0.923	0.35
90_V	114_S	0.896	0.34
88_M	101_V	0.891	0.33
54_L	58_R	0.887	0.33
39_R	112_E	0.887	0.33
57_V	119_K	0.876	0.33
24_N	32_K	0.874	0.33
26_P	29_E	0.867	0.32
83_L	112_E	0.855	0.31
87_K	99_F	0.845	0.31
10_K	125_P	0.840	0.31
129_A	133_S	0.827	0.30
10_K	41_S	0.825	0.30
122_H	126_G	0.825	0.30
12_F	53_L	0.823	0.30
128_K	138_M	0.820	0.30
30_F	33_L	0.820	0.30
40_R	44_R	0.817	0.29
69_T	76_N	0.816	0.29
36_S	74_V	0.804	0.29
15_R	75_R	0.804	0.29
128_K	133_S	0.800	0.29
41_S	50_Q	0.797	0.28
22_L	47_T	0.795	0.28
102_T	106_I	0.792	0.28
91_Y	114_S	0.786	0.28
14_Y	39_R	0.777	0.27
69_T	98_E	0.774	0.27
43_K	54_L	0.774	0.27
90_V	110_L	0.770	0.27
78_V	119_K	0.767	0.27
45_G	83_L	0.766	0.27
30_F	35_P	0.760	0.27
74_V	82_E	0.758	0.27
71_K	118_K	0.756	0.26
75_R	122_H	0.752	0.26
49_A	54_L	0.739	0.26
74_V	125_P	0.734	0.25
30_F	109_Y	0.729	0.25
55_E	84_I	0.727	0.25
68_K	102_T	0.726	0.25
9_W	124_E	0.722	0.25
23_L	136_L	0.720	0.25
134_L	138_M	0.709	0.24
22_L	106_I	0.709	0.24
135_F	138_M	0.707	0.24
55_E	88_M	0.705	0.24
70_I	87_K	0.702	0.24
69_T	121_E	0.692	0.23
117_T	134_L	0.692	0.23
129_A	139_K	0.688	0.23
28_D	54_L	0.686	0.23
95_E	98_E	0.678	0.23
21_E	26_P	0.676	0.23
17_K	33_L	0.671	0.23
93_G	107_G	0.665	0.22
43_K	79_I	0.656	0.22
34_L	107_G	0.655	0.22
85_G	100_T	0.654	0.22
112_E	120_V	0.653	0.22
59_K	63_E	0.652	0.22
28_D	38_Q	0.649	0.22
74_V	120_V	0.639	0.21
31_I	43_K	0.636	0.21
15_R	105_M	0.635	0.21
32_K	52_H	0.633	0.21
47_T	57_V	0.628	0.21
90_V	96_F	0.626	0.21
94_K	103_P	0.623	0.21
45_G	96_F	0.623	0.21
63_E	80_L	0.621	0.20
13_K	19_I	0.615	0.20
27_M	79_I	0.615	0.20
16_G	83_L	0.609	0.20
21_E	84_I	0.607	0.20
15_R	84_I	0.607	0.20
20_D	56_K	0.605	0.20
88_M	114_S	0.599	0.20
99_F	136_L	0.598	0.20
65_K	68_K	0.596	0.19
58_R	96_F	0.595	0.19
59_K	130_T	0.594	0.19
37_R	40_R	0.593	0.19
74_V	109_Y	0.586	0.19
40_R	107_G	0.585	0.19
124_E	128_K	0.583	0.19
12_F	19_I	0.570	0.18
9_W	17_K	0.569	0.18
34_L	51_R	0.568	0.18
11_N	136_L	0.559	0.18
68_K	71_K	0.559	0.18
80_L	108_H	0.557	0.18
16_G	107_G	0.556	0.18
57_V	95_E	0.554	0.18
96_F	129_A	0.551	0.18
29_E	89_A	0.550	0.18
94_K	120_V	0.547	0.18
127_L	131_R	0.546	0.18
43_K	50_Q	0.544	0.18
91_Y	117_T	0.541	0.17
59_K	74_V	0.541	0.17
97_V	120_V	0.540	0.17
50_Q	130_T	0.539	0.17
44_R	61_R	0.529	0.17
10_K	86_L	0.527	0.17
48_D	52_H	0.522	0.17
109_Y	116_T	0.514	0.16
69_T	99_F	0.513	0.16
94_K	114_S	0.513	0.16
67_N	89_A	0.510	0.16
82_E	114_S	0.509	0.16
54_L	69_T	0.507	0.16
12_F	72_T	0.506	0.16
124_E	137_A	0.504	0.16
100_T	113_Y	0.501	0.16
39_R	122_H	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4w23P	1	0.6643	100	0.138	Contact Map
3j38P	1	0.8643	100	0.14	Contact Map
3zeyI	1	0.9286	100	0.16	Contact Map
3j7aX	1	0.6643	100	0.162	Contact Map
4ujpQ	1	0.8643	100	0.208	Contact Map
3j20T	1	0.7929	100	0.218	Contact Map
4bpeS	1	0.8286	100	0.227	Contact Map
3bbnS	1	0.6571	100	0.565	Contact Map
4kiyS	1	0.5643	100	0.576	Contact Map
3a1pB	1	0.6071	100	0.58	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.