RL22 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL22 - 50S ribosomal protein L22

UniProt:	Q9UXA2	Sequences: MASWKYPQLDVDELKIAKAVIRDVPESIRDLYNVCKAIRGMYLNDAKDFLNRVLEEKEALPFWRYNKGASHKSNISAKWKIKAGRYPKKAIRQVLKVLENAEANATNKGLDVDKLIIRHIAAHKGITLQRYMPRAFGRATAKYRRTSNIEVILEEVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	157 (149)
Sequences:	493 (299)
Seq/√Len:	24.5

HALSA - RL22
SULSO - RL22

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_R	58_E	6.011	1.00
101_A	153_L	5.862	1.00
45_D	58_E	4.084	1.00
23_D	126_I	3.560	1.00
49_F	60_L	3.452	1.00
47_K	102_E	3.062	1.00
59_A	72_K	2.948	1.00
59_A	75_I	2.924	1.00
21_I	24_V	2.653	0.99
54_L	91_I	2.625	0.99
52_R	57_K	2.585	0.99
35_C	94_V	2.383	0.98
45_D	52_R	2.275	0.97
30_D	90_A	1.972	0.94
60_L	91_I	1.940	0.94
72_K	75_I	1.814	0.91
65_Y	124_K	1.805	0.91
34_V	90_A	1.799	0.91
47_K	51_N	1.783	0.90
51_N	95_L	1.773	0.90
59_A	84_G	1.725	0.89
121_A	150_E	1.666	0.87
31_L	90_A	1.660	0.87
43_L	151_V	1.645	0.86
30_D	34_V	1.588	0.84
88_K	92_R	1.578	0.84
62_F	66_N	1.521	0.82
34_V	91_I	1.484	0.80
115_L	148_N	1.452	0.78
118_R	154_E	1.450	0.78
69_A	83_A	1.435	0.78
17_A	153_L	1.426	0.77
34_V	94_V	1.395	0.75
54_L	60_L	1.393	0.75
49_F	79_W	1.378	0.75
99_E	102_E	1.349	0.73
74_N	86_Y	1.347	0.73
45_D	92_R	1.248	0.67
35_C	151_V	1.238	0.66
67_K	73_S	1.237	0.66
51_N	55_E	1.233	0.66
117_I	120_I	1.223	0.65
42_Y	116_I	1.212	0.65
66_N	69_A	1.200	0.64
75_I	84_G	1.188	0.63
51_N	88_K	1.182	0.63
32_Y	64_R	1.163	0.61
27_S	62_F	1.156	0.61
132_M	142_K	1.145	0.60
35_C	120_I	1.144	0.60
37_A	60_L	1.141	0.60
21_I	97_V	1.136	0.59
17_A	101_A	1.105	0.57
30_D	71_H	1.089	0.56
26_E	118_R	1.074	0.55
33_N	70_S	1.062	0.54
47_K	99_E	1.058	0.54
16_I	154_E	1.050	0.53
41_M	45_D	1.042	0.53
43_L	47_K	1.039	0.53
42_Y	45_D	1.037	0.52
26_E	31_L	1.027	0.52
37_A	49_F	1.020	0.51
111_D	155_E	1.012	0.51
38_I	81_I	1.011	0.51
64_R	138_R	0.985	0.49
73_S	76_S	0.972	0.48
135_A	150_E	0.955	0.47
133_P	139_A	0.952	0.46
61_P	98_L	0.952	0.46
56_E	60_L	0.947	0.46
131_Y	146_T	0.940	0.46
132_M	140_T	0.939	0.45
28_I	65_Y	0.932	0.45
80_K	91_I	0.921	0.44
106_T	155_E	0.913	0.44
31_L	94_V	0.909	0.43
95_L	102_E	0.907	0.43
109_G	155_E	0.902	0.43
9_L	13_E	0.897	0.42
63_W	85_R	0.896	0.42
128_L	144_R	0.895	0.42
25_P	43_L	0.894	0.42
112_V	115_L	0.891	0.42
59_A	74_N	0.872	0.41
68_G	75_I	0.869	0.41
144_R	147_S	0.850	0.39
45_D	57_K	0.842	0.39
19_A	63_W	0.841	0.39
39_R	67_K	0.837	0.38
51_N	111_D	0.836	0.38
7_P	119_H	0.833	0.38
31_L	34_V	0.832	0.38
60_L	81_I	0.823	0.37
70_S	126_I	0.813	0.37
53_V	61_P	0.811	0.37
67_K	136_F	0.810	0.37
39_R	119_H	0.805	0.36
7_P	150_E	0.801	0.36
28_I	123_H	0.799	0.36
61_P	89_K	0.799	0.36
40_G	80_K	0.796	0.36
130_R	143_Y	0.782	0.35
106_T	112_V	0.780	0.35
98_L	115_L	0.778	0.34
18_K	98_L	0.777	0.34
36_K	128_L	0.775	0.34
10_D	16_I	0.775	0.34
65_Y	83_A	0.775	0.34
125_G	146_T	0.775	0.34
64_R	85_R	0.765	0.34
62_F	69_A	0.765	0.34
62_F	83_A	0.761	0.33
103_A	114_K	0.760	0.33
27_S	145_R	0.754	0.33
30_D	69_A	0.752	0.33
66_N	83_A	0.750	0.33
138_R	141_A	0.748	0.32
40_G	104_N	0.748	0.32
12_D	15_K	0.742	0.32
7_P	117_I	0.737	0.32
12_D	94_V	0.737	0.32
72_K	84_G	0.732	0.31
131_Y	147_S	0.725	0.31
85_R	134_R	0.723	0.31
125_G	133_P	0.716	0.31
53_V	137_G	0.714	0.30
4_W	20_V	0.713	0.30
115_L	153_L	0.712	0.30
69_A	72_K	0.712	0.30
11_V	18_K	0.711	0.30
20_V	150_E	0.705	0.30
62_F	85_R	0.704	0.30
23_D	150_E	0.703	0.30
13_E	16_I	0.692	0.29
43_L	102_E	0.692	0.29
80_K	84_G	0.690	0.29
48_D	123_H	0.681	0.28
26_E	143_Y	0.680	0.28
47_K	95_L	0.671	0.28
92_R	111_D	0.671	0.28
47_K	54_L	0.669	0.28
118_R	124_K	0.669	0.28
33_N	141_A	0.669	0.28
93_Q	99_E	0.668	0.28
133_P	140_T	0.668	0.28
120_I	153_L	0.667	0.28
23_D	148_N	0.666	0.28
56_E	59_A	0.662	0.27
34_V	38_I	0.662	0.27
13_E	18_K	0.661	0.27
142_K	146_T	0.660	0.27
21_I	57_K	0.659	0.27
102_E	105_A	0.658	0.27
25_P	130_R	0.657	0.27
16_I	108_K	0.655	0.27
4_W	19_A	0.651	0.27
27_S	35_C	0.649	0.27
54_L	59_A	0.644	0.26
109_G	150_E	0.635	0.26
21_I	101_A	0.629	0.25
25_P	144_R	0.628	0.25
125_G	131_Y	0.627	0.25
35_C	122_A	0.626	0.25
28_I	146_T	0.625	0.25
9_L	16_I	0.623	0.25
7_P	121_A	0.620	0.25
76_S	133_P	0.618	0.25
44_N	113_D	0.617	0.25
93_Q	140_T	0.616	0.25
58_E	79_W	0.615	0.25
120_I	151_V	0.615	0.25
42_Y	114_K	0.614	0.25
30_D	70_S	0.608	0.24
122_A	147_S	0.608	0.24
81_I	84_G	0.604	0.24
10_D	113_D	0.602	0.24
53_V	62_F	0.600	0.24
64_R	141_A	0.596	0.24
100_N	132_M	0.592	0.24
72_K	79_W	0.591	0.23
5_K	120_I	0.589	0.23
36_K	39_R	0.587	0.23
10_D	18_K	0.587	0.23
139_A	146_T	0.581	0.23
124_K	127_T	0.580	0.23
131_Y	139_A	0.580	0.23
19_A	39_R	0.579	0.23
24_V	39_R	0.574	0.23
53_V	87_P	0.569	0.22
4_W	7_P	0.569	0.22
136_F	146_T	0.563	0.22
131_Y	136_F	0.562	0.22
50_L	53_V	0.558	0.22
48_D	52_R	0.557	0.22
140_T	143_Y	0.553	0.22
63_W	81_I	0.552	0.22
62_F	107_N	0.552	0.22
108_K	127_T	0.549	0.21
107_N	128_L	0.549	0.21
32_Y	112_V	0.548	0.21
92_R	117_I	0.543	0.21
12_D	155_E	0.542	0.21
4_W	9_L	0.541	0.21
30_D	76_S	0.541	0.21
41_M	114_K	0.535	0.21
5_K	79_W	0.532	0.21
130_R	142_K	0.526	0.20
63_W	91_I	0.526	0.20
104_N	149_I	0.523	0.20
19_A	119_H	0.523	0.20
34_V	92_R	0.522	0.20
79_W	113_D	0.520	0.20
126_I	148_N	0.517	0.20
49_F	52_R	0.510	0.20
21_I	123_H	0.507	0.19
85_R	105_A	0.507	0.19
23_D	92_R	0.506	0.19
75_I	83_A	0.505	0.19
9_L	14_L	0.504	0.19
132_M	146_T	0.504	0.19
115_L	121_A	0.501	0.19
101_A	117_I	0.501	0.19
23_D	30_D	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a17Q	1	0.9873	100	0.162	Contact Map
1vx7W	1	0.9618	100	0.167	Contact Map
3j39P	1	0.9745	100	0.177	Contact Map
4ujrC	1	0.9745	100	0.18	Contact Map
3j61P	1	0.9873	100	0.184	Contact Map
1vq8R	1	0.9554	100	0.192	Contact Map
3zf7R	1	0.9745	100	0.2	Contact Map
3j21S	1	0.949	100	0.202	Contact Map
3j3bP	1	0.9682	100	0.221	Contact Map
4w20P	1	0.9745	100	0.227	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.