RS3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS3 - 30S ribosomal protein S3

UniProt:	Q9UXA0	Sequences: MPNIKRYFLEKSIVKVKIDEYLAKQYYNAEYAGVEVLKTPIGTRVIIYAGRPSMIIGRGGRNIKQLAQIFEKVFGLENPQITITNVENPELNARVMAFRLAIALEKGYHFRRAAFISMRRIMNAGALGAEIIISGKLTTERARYEKLKEGIVYKSGQQLEKMIDRAIAIAMLKPGIFGVEVVITKPLKIEDKINLKESPSVPQEVSVTNVTFIEESSQKSEEKSEGEKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	229 (189)
Sequences:	2574 (1218)
Seq/√Len:	88.6

ECOLI - RS3
BACSU - RS3
HALSA - RS3
SULSO - RS3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_A	92_N	5.182	1.00
96_M	183_I	4.246	1.00
171_M	176_I	4.219	1.00
169_I	176_I	3.846	1.00
25_Q	69_I	3.820	1.00
91_L	126_A	3.284	1.00
62_N	65_Q	2.967	1.00
46_I	82_T	2.854	1.00
23_A	94_R	2.840	1.00
116_I	120_R	2.730	1.00
121_I	129_A	2.539	1.00
132_I	144_Y	2.365	1.00
105_E	170_A	2.360	1.00
184_T	187_L	2.315	1.00
108_Y	113_A	2.242	1.00
94_R	98_F	2.142	1.00
100_L	131_I	2.109	1.00
98_F	168_A	2.103	1.00
151_I	184_T	2.092	1.00
7_Y	10_E	1.986	1.00
49_A	55_I	1.958	1.00
93_A	164_D	1.920	1.00
26_Y	55_I	1.890	1.00
33_G	48_Y	1.813	1.00
104_L	110_F	1.750	1.00
17_K	73_V	1.704	1.00
23_A	98_F	1.671	1.00
13_I	17_K	1.664	1.00
94_R	168_A	1.602	1.00
48_Y	84_T	1.595	1.00
161_K	184_T	1.594	1.00
94_R	167_I	1.580	1.00
94_R	166_A	1.552	1.00
100_L	113_A	1.539	1.00
132_I	146_K	1.496	1.00
13_I	16_V	1.494	1.00
21_Y	69_I	1.470	0.99
64_K	68_Q	1.454	0.99
148_K	151_I	1.405	0.99
127_L	151_I	1.396	0.99
162_M	185_K	1.396	0.99
133_I	177_F	1.392	0.99
114_A	147_L	1.392	0.99
148_K	152_V	1.370	0.99
91_L	121_I	1.364	0.99
110_F	137_L	1.360	0.99
22_L	34_V	1.355	0.99
26_Y	66_L	1.324	0.99
97_A	168_A	1.321	0.99
104_L	177_F	1.319	0.99
42_G	78_N	1.318	0.99
46_I	84_T	1.309	0.99
59_G	116_I	1.308	0.99
65_Q	69_I	1.293	0.99
118_M	129_A	1.292	0.99
65_Q	68_Q	1.286	0.99
191_D	194_N	1.280	0.99
57_G	60_G	1.277	0.99
22_L	31_Y	1.277	0.99
16_V	20_E	1.267	0.98
134_S	144_Y	1.258	0.98
97_A	179_V	1.253	0.98
8_F	12_S	1.234	0.98
12_S	16_V	1.224	0.98
30_E	49_A	1.224	0.98
37_L	44_R	1.221	0.98
68_Q	72_K	1.215	0.98
14_V	77_E	1.214	0.98
8_F	13_I	1.208	0.98
118_M	131_I	1.195	0.98
25_Q	65_Q	1.188	0.98
99_R	102_I	1.181	0.98
96_M	117_S	1.159	0.97
130_E	154_K	1.155	0.97
29_A	49_A	1.153	0.97
97_A	181_V	1.149	0.97
17_K	20_E	1.147	0.97
100_L	117_S	1.146	0.97
102_I	106_K	1.145	0.97
22_L	26_Y	1.143	0.97
53_S	85_N	1.135	0.97
146_K	151_I	1.130	0.97
114_A	133_I	1.115	0.97
101_A	179_V	1.110	0.96
9_L	13_I	1.099	0.96
63_I	74_F	1.093	0.96
101_A	168_A	1.080	0.96
29_A	54_M	1.072	0.96
22_L	45_V	1.060	0.95
88_N	124_A	1.058	0.95
115_F	138_T	1.056	0.95
68_Q	71_E	1.056	0.95
98_F	102_I	1.047	0.95
71_E	78_N	1.039	0.95
119_R	149_E	1.029	0.95
96_M	121_I	1.020	0.94
33_G	92_N	1.010	0.94
162_M	188_K	1.002	0.94
52_P	56_I	0.951	0.92
193_I	196_K	0.948	0.92
136_K	174_P	0.945	0.92
23_A	27_Y	0.945	0.92
21_Y	70_F	0.939	0.91
121_I	183_I	0.927	0.91
10_E	77_E	0.925	0.91
109_H	138_T	0.924	0.91
31_Y	47_I	0.910	0.90
61_R	65_Q	0.909	0.90
24_K	27_Y	0.904	0.90
120_R	123_N	0.899	0.89
137_L	174_P	0.897	0.89
74_F	79_P	0.895	0.89
119_R	123_N	0.891	0.89
190_E	193_I	0.882	0.89
191_D	195_L	0.880	0.88
110_F	145_E	0.877	0.88
131_I	147_L	0.873	0.88
99_R	103_A	0.870	0.88
42_G	80_Q	0.867	0.88
91_L	183_I	0.841	0.86
53_S	56_I	0.840	0.86
74_F	77_E	0.840	0.86
55_I	83_I	0.839	0.86
53_S	57_G	0.835	0.86
191_D	196_K	0.833	0.86
153_Y	161_K	0.827	0.85
164_D	185_K	0.825	0.85
53_S	60_G	0.818	0.85
43_T	77_E	0.812	0.84
53_S	58_R	0.811	0.84
91_L	185_K	0.811	0.84
118_M	147_L	0.796	0.83
90_E	124_A	0.789	0.82
20_E	24_K	0.777	0.81
70_F	79_P	0.777	0.81
146_K	152_V	0.777	0.81
7_Y	11_K	0.776	0.81
110_F	138_T	0.772	0.81
35_E	48_Y	0.772	0.81
56_I	60_G	0.769	0.81
30_E	50_G	0.768	0.81
59_G	120_R	0.767	0.81
152_V	184_T	0.763	0.80
44_R	82_T	0.762	0.80
189_I	193_I	0.757	0.80
10_E	13_I	0.757	0.80
190_E	194_N	0.745	0.79
118_M	149_E	0.738	0.78
60_G	85_N	0.735	0.78
154_K	182_V	0.735	0.78
165_R	182_V	0.734	0.78
26_Y	47_I	0.731	0.77
118_M	184_T	0.730	0.77
15_K	19_D	0.726	0.77
131_I	146_K	0.722	0.76
161_K	186_P	0.719	0.76
104_L	145_E	0.719	0.76
73_V	79_P	0.718	0.76
29_A	52_P	0.716	0.76
108_Y	112_R	0.714	0.76
60_G	63_I	0.712	0.75
113_A	133_I	0.710	0.75
134_S	141_R	0.709	0.75
132_I	148_K	0.699	0.74
153_Y	184_T	0.699	0.74
115_F	142_A	0.695	0.74
88_N	91_L	0.691	0.73
131_I	179_V	0.690	0.73
111_R	145_E	0.690	0.73
110_F	173_K	0.685	0.73
38_K	93_A	0.684	0.72
35_E	62_N	0.681	0.72
5_K	9_L	0.681	0.72
157_Q	161_K	0.678	0.72
21_Y	25_Q	0.674	0.71
51_R	90_E	0.671	0.71
71_E	80_Q	0.670	0.71
116_I	119_R	0.670	0.71
14_V	17_K	0.666	0.70
127_L	184_T	0.656	0.69
106_K	141_R	0.652	0.69
104_L	111_R	0.650	0.69
24_K	73_V	0.645	0.68
7_Y	59_G	0.643	0.68
157_Q	184_T	0.642	0.68
122_M	126_A	0.642	0.68
35_E	46_I	0.641	0.68
20_E	63_I	0.639	0.67
115_F	154_K	0.638	0.67
90_E	120_R	0.637	0.67
31_Y	49_A	0.634	0.67
39_T	42_G	0.634	0.67
26_Y	31_Y	0.630	0.66
114_A	166_A	0.629	0.66
15_K	107_G	0.626	0.66
49_A	137_L	0.625	0.66
11_K	14_V	0.624	0.65
97_A	166_A	0.620	0.65
43_T	74_F	0.619	0.65
165_R	180_E	0.619	0.65
91_L	124_A	0.618	0.65
100_L	181_V	0.616	0.64
13_I	179_V	0.615	0.64
112_R	116_I	0.614	0.64
44_R	106_K	0.611	0.64
130_E	136_K	0.608	0.63
65_Q	72_K	0.605	0.63
119_R	124_A	0.605	0.63
39_T	44_R	0.604	0.63
101_A	105_E	0.602	0.63
19_D	153_Y	0.598	0.62
133_I	138_T	0.597	0.62
137_L	177_F	0.597	0.62
44_R	188_K	0.597	0.62
121_I	126_A	0.596	0.62
90_E	96_M	0.592	0.61
14_V	74_F	0.589	0.61
174_P	177_F	0.585	0.60
24_K	191_D	0.585	0.60
146_K	174_P	0.582	0.60
27_Y	105_E	0.580	0.60
192_K	195_L	0.579	0.60
135_G	175_G	0.575	0.59
106_K	146_K	0.575	0.59
6_R	80_Q	0.574	0.59
127_L	186_P	0.573	0.59
19_D	140_E	0.570	0.59
9_L	12_S	0.570	0.59
119_R	190_E	0.570	0.59
37_L	46_I	0.569	0.58
38_K	143_R	0.568	0.58
51_R	57_G	0.566	0.58
15_K	36_V	0.565	0.58
128_G	135_G	0.565	0.58
141_R	146_K	0.562	0.57
104_L	117_S	0.562	0.57
41_I	191_D	0.562	0.57
41_I	78_N	0.561	0.57
130_E	138_T	0.561	0.57
5_K	146_K	0.559	0.57
35_E	84_T	0.554	0.56
154_K	172_L	0.552	0.56
141_R	144_Y	0.551	0.56
63_I	83_I	0.550	0.56
89_P	125_G	0.549	0.56
173_K	186_P	0.548	0.56
136_K	182_V	0.547	0.55
39_T	116_I	0.546	0.55
58_R	88_N	0.546	0.55
24_K	72_K	0.540	0.54
121_I	185_K	0.539	0.54
52_P	57_G	0.537	0.54
114_A	131_I	0.535	0.54
158_Q	182_V	0.535	0.54
192_K	196_K	0.534	0.54
28_N	88_N	0.534	0.54
19_D	36_V	0.534	0.54
190_E	196_K	0.533	0.54
45_V	81_I	0.529	0.53
44_R	65_Q	0.528	0.53
102_I	116_I	0.527	0.53
126_A	137_L	0.527	0.53
99_R	152_V	0.526	0.53
18_I	74_F	0.526	0.53
12_S	15_K	0.526	0.53
16_V	152_V	0.524	0.52
50_G	95_V	0.522	0.52
153_Y	180_E	0.522	0.52
15_K	153_Y	0.521	0.52
139_T	177_F	0.520	0.52
136_K	165_R	0.519	0.52
51_R	70_F	0.519	0.52
42_G	77_E	0.518	0.51
170_A	177_F	0.510	0.50
39_T	67_A	0.510	0.50
18_I	80_Q	0.509	0.50
136_K	172_L	0.505	0.50
65_Q	81_I	0.505	0.50
107_G	154_K	0.503	0.49
5_K	16_V	0.501	0.49
14_V	22_L	0.501	0.49
150_G	178_G	0.501	0.49
128_G	175_G	0.500	0.49
22_L	51_R	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rb5C	1	0.8079	100	0.145	Contact Map
3j20C	1	0.8035	100	0.147	Contact Map
4kiyC	1	0.8079	100	0.157	Contact Map
3j7aD	1	0.6725	100	0.164	Contact Map
4tp8C	1	0.8079	100	0.166	Contact Map
3zeyX	1	0.8865	100	0.167	Contact Map
4w23D	1	0.9694	100	0.175	Contact Map
3bbnC	1	0.8079	100	0.182	Contact Map
4ujpE	1	0.9258	100	0.189	Contact Map
4bpeC	1	0.952	100	0.189	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.