RS17 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS17 - 30S ribosomal protein S17P

UniProt:	Q9UX98	Sequences: MVSKGKTVKDPGIPNITIPEKVCEDEDCPYHGSLRVRGITLEGVIVKYRGTKAAVIERQYLYYDSKYKRYERRRSRIHAHVPPCINVREGDKVIIGECRPLSKSISFVVLGKVS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	114 (103)
Sequences:	385 (181)
Seq/√Len:	17.8

HALSA - RS17
SULSO - RS17

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_V	78_H	4.657	1.00
96_G	110_L	4.139	1.00
81_V	87_V	4.091	1.00
53_A	105_I	3.987	1.00
23_C	31_H	3.543	1.00
79_A	95_I	2.717	0.98
56_I	95_I	2.340	0.94
30_Y	98_C	2.146	0.91
54_A	81_V	2.111	0.91
11_P	110_L	1.955	0.87
77_I	95_I	1.930	0.86
47_K	97_E	1.828	0.83
97_E	106_S	1.798	0.82
57_E	76_R	1.693	0.78
31_H	84_C	1.679	0.77
63_Y	68_K	1.668	0.76
17_T	20_E	1.501	0.68
46_V	54_A	1.476	0.67
28_C	31_H	1.386	0.62
49_R	53_A	1.379	0.62
54_A	109_V	1.341	0.59
23_C	84_C	1.330	0.59
28_C	84_C	1.312	0.58
68_K	72_R	1.292	0.56
42_E	92_K	1.276	0.55
19_P	28_C	1.273	0.55
59_Q	74_R	1.213	0.52
45_I	54_A	1.207	0.51
17_T	40_T	1.203	0.51
56_I	92_K	1.200	0.51
48_Y	81_V	1.177	0.49
68_K	111_G	1.141	0.47
48_Y	89_E	1.138	0.47
16_I	34_L	1.131	0.47
45_I	81_V	1.122	0.46
23_C	85_I	1.114	0.46
25_D	88_R	1.101	0.45
69_R	90_G	1.090	0.44
77_I	89_E	1.088	0.44
10_D	59_Q	1.076	0.43
13_I	107_F	1.075	0.43
27_D	101_L	1.072	0.43
27_D	33_S	1.068	0.43
44_V	51_T	1.062	0.42
42_E	46_V	1.047	0.42
98_C	111_G	1.040	0.41
94_I	111_G	1.023	0.40
19_P	31_H	1.020	0.40
23_C	28_C	0.994	0.38
72_R	100_P	0.988	0.38
43_G	80_H	0.966	0.37
56_I	98_C	0.959	0.36
24_E	31_H	0.956	0.36
36_V	108_V	0.954	0.36
87_V	105_I	0.945	0.36
44_V	92_K	0.945	0.36
76_R	96_G	0.939	0.35
48_Y	79_A	0.939	0.35
27_D	80_H	0.936	0.35
50_G	72_R	0.934	0.35
16_I	23_C	0.932	0.35
75_S	92_K	0.926	0.35
69_R	73_R	0.924	0.34
34_L	41_L	0.921	0.34
74_R	96_G	0.910	0.34
81_V	84_C	0.890	0.33
15_N	39_I	0.879	0.32
57_E	74_R	0.862	0.31
66_K	93_V	0.854	0.31
105_I	110_L	0.841	0.30
16_I	110_L	0.835	0.30
102_S	105_I	0.808	0.28
35_R	39_I	0.804	0.28
8_V	86_N	0.800	0.28
24_E	49_R	0.783	0.27
40_T	81_V	0.777	0.27
21_K	88_R	0.769	0.26
54_A	79_A	0.768	0.26
27_D	34_L	0.751	0.26
78_H	102_S	0.751	0.26
11_P	32_G	0.746	0.25
9_K	60_Y	0.740	0.25
12_G	58_R	0.738	0.25
69_R	102_S	0.724	0.24
46_V	79_A	0.724	0.24
48_Y	54_A	0.723	0.24
21_K	50_G	0.723	0.24
17_T	33_S	0.716	0.24
58_R	98_C	0.713	0.24
41_L	52_K	0.711	0.24
40_T	96_G	0.705	0.24
70_Y	100_P	0.702	0.23
10_D	13_I	0.698	0.23
42_E	94_I	0.698	0.23
64_D	71_E	0.693	0.23
81_V	105_I	0.689	0.23
27_D	30_Y	0.686	0.23
44_V	59_Q	0.685	0.23
46_V	89_E	0.684	0.23
82_P	85_I	0.683	0.23
41_L	60_Y	0.676	0.22
33_S	92_K	0.673	0.22
39_I	63_Y	0.672	0.22
42_E	89_E	0.670	0.22
55_V	106_S	0.658	0.22
34_L	82_P	0.654	0.21
46_V	77_I	0.647	0.21
16_I	92_K	0.644	0.21
51_T	75_S	0.642	0.21
41_L	74_R	0.637	0.21
30_Y	58_R	0.635	0.21
9_K	35_R	0.635	0.21
32_G	91_D	0.631	0.20
13_I	36_V	0.621	0.20
41_L	64_D	0.619	0.20
62_Y	71_E	0.617	0.20
52_K	83_P	0.614	0.20
69_R	103_K	0.611	0.20
35_R	98_C	0.607	0.19
37_R	43_G	0.606	0.19
41_L	101_L	0.606	0.19
70_Y	94_I	0.603	0.19
58_R	69_R	0.602	0.19
80_H	83_P	0.601	0.19
99_R	103_K	0.597	0.19
34_L	101_L	0.588	0.19
39_I	72_R	0.584	0.19
58_R	72_R	0.580	0.18
26_E	33_S	0.578	0.18
42_E	88_R	0.573	0.18
73_R	89_E	0.571	0.18
21_K	111_G	0.565	0.18
11_P	106_S	0.561	0.18
25_D	28_C	0.545	0.17
19_P	84_C	0.544	0.17
57_E	69_R	0.539	0.17
47_K	110_L	0.538	0.17
22_V	85_I	0.538	0.17
60_Y	63_Y	0.537	0.17
80_H	101_L	0.534	0.17
55_V	109_V	0.532	0.17
26_E	101_L	0.525	0.17
30_Y	94_I	0.521	0.16
15_N	96_G	0.519	0.16
15_N	72_R	0.515	0.16
41_L	95_I	0.510	0.16
83_P	100_P	0.509	0.16
65_S	75_S	0.507	0.16
26_E	58_R	0.507	0.16
30_Y	35_R	0.507	0.16
56_I	64_D	0.507	0.16
71_E	99_R	0.506	0.16
23_C	27_D	0.504	0.16
12_G	29_P	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4w23L	1	0.9912	100	0.271	Contact Map
3zeyE	1	0.9912	100	0.271	Contact Map
3j60L	1	0.7105	100	0.272	Contact Map
3j7aV	1	0.9474	100	0.273	Contact Map
4ujpM	1	0.9912	100	0.274	Contact Map
4bpeQ	1	0.9912	100	0.276	Contact Map
3j20R	1	0.9386	100	0.283	Contact Map
3bbnQ	1	0.6579	100	0.422	Contact Map
4rb5Q	1	0.6754	99.9	0.551	Contact Map
1qd7I	1	0.6754	99.9	0.552	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.