RL14 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL14 - 50S ribosomal protein L14

UniProt:	Q9UX97	Sequences: MSEKIQVLGSRKGLTPALQHYSVVNVADNSGGKEAMIIGVYGYRGVLRRVPFANIADMVMVSIKKGTPEVRKQKFRAVIVRQRMPYRRPDGTWISFEDNAVVIINPDGTPKGTEVRGPIAREAAERWPKIASLATLVV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (118)
Sequences:	1566 (564)
Seq/√Len:	51.9

ECOLI - RL14
BACSU - RL14
HALSA - RL14
SULSO - RL14

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_V	75_F	4.857	1.00
35_A	101_V	4.138	1.00
37_I	59_V	3.718	1.00
35_A	61_V	3.168	1.00
23_V	34_E	3.014	1.00
18_L	37_I	2.829	1.00
36_M	64_K	2.668	1.00
21_Y	36_M	2.620	1.00
77_A	101_V	2.512	1.00
34_E	65_K	2.290	1.00
41_Y	60_M	2.196	1.00
87_R	93_W	2.139	1.00
18_L	22_S	2.056	1.00
35_A	63_I	2.031	1.00
60_M	76_R	1.983	1.00
103_I	111_K	1.963	1.00
53_A	79_I	1.868	0.99
19_Q	22_S	1.864	0.99
25_N	98_D	1.837	0.99
123_A	131_A	1.803	0.99
23_V	36_M	1.742	0.99
26_V	35_A	1.737	0.99
105_N	109_T	1.705	0.99
76_R	106_P	1.672	0.98
54_N	86_Y	1.657	0.98
20_H	39_G	1.606	0.98
25_N	34_E	1.581	0.98
49_R	52_F	1.551	0.98
94_I	138_V	1.526	0.97
54_N	85_P	1.506	0.97
36_M	62_S	1.471	0.97
88_R	122_E	1.438	0.96
111_K	125_E	1.427	0.96
58_M	127_W	1.302	0.93
80_V	119_I	1.253	0.92
58_M	104_I	1.238	0.91
124_A	128_P	1.161	0.88
20_H	36_M	1.145	0.88
119_I	123_A	1.139	0.88
108_G	127_W	1.131	0.87
23_V	64_K	1.126	0.87
129_K	132_S	1.092	0.85
26_V	101_V	1.080	0.85
30_S	111_K	1.074	0.84
100_A	125_E	1.071	0.84
55_I	86_Y	1.043	0.82
59_V	79_I	1.027	0.81
38_I	138_V	1.021	0.81
24_V	35_A	0.999	0.80
81_R	117_G	0.987	0.79
40_V	53_A	0.972	0.78
27_A	118_P	0.933	0.75
81_R	98_D	0.927	0.74
30_S	112_G	0.911	0.73
128_P	131_A	0.911	0.73
119_I	130_I	0.898	0.72
69_E	73_Q	0.890	0.71
65_K	118_P	0.887	0.71
55_I	85_P	0.887	0.71
58_M	108_G	0.882	0.71
77_A	103_I	0.875	0.70
105_N	111_K	0.864	0.69
81_R	100_A	0.857	0.68
27_A	80_V	0.857	0.68
35_A	79_I	0.854	0.68
30_S	39_G	0.853	0.68
23_V	62_S	0.842	0.67
34_E	64_K	0.828	0.66
70_V	74_K	0.828	0.66
17_A	114_E	0.821	0.65
65_K	72_K	0.821	0.65
24_V	101_V	0.818	0.65
39_G	47_L	0.810	0.64
40_V	49_R	0.807	0.64
88_R	100_A	0.806	0.64
131_A	138_V	0.804	0.63
88_R	91_G	0.804	0.63
45_G	49_R	0.798	0.63
105_N	108_G	0.798	0.63
70_V	73_Q	0.797	0.63
82_Q	86_Y	0.794	0.62
61_V	103_I	0.793	0.62
18_L	24_V	0.790	0.62
78_V	127_W	0.781	0.61
38_I	73_Q	0.774	0.60
24_V	59_V	0.767	0.60
123_A	126_R	0.766	0.60
85_P	93_W	0.763	0.59
61_V	101_V	0.758	0.59
104_I	108_G	0.748	0.58
39_G	46_V	0.740	0.57
75_F	103_I	0.731	0.56
85_P	95_S	0.730	0.56
32_G	70_V	0.728	0.56
120_A	125_E	0.725	0.55
80_V	102_V	0.725	0.55
75_F	111_K	0.724	0.55
48_R	79_I	0.722	0.55
33_K	45_G	0.716	0.54
33_K	38_I	0.711	0.54
71_R	127_W	0.707	0.54
116_R	136_L	0.706	0.53
38_I	47_L	0.697	0.52
33_K	67_T	0.694	0.52
30_S	67_T	0.691	0.52
114_E	133_L	0.687	0.51
41_Y	76_R	0.677	0.50
91_G	100_A	0.675	0.50
42_G	121_R	0.673	0.50
32_G	104_I	0.671	0.50
110_P	133_L	0.671	0.50
131_A	135_T	0.669	0.50
107_D	111_K	0.660	0.49
67_T	70_V	0.657	0.48
124_A	137_V	0.656	0.48
81_R	118_P	0.655	0.48
27_A	110_P	0.645	0.47
98_D	118_P	0.645	0.47
135_T	138_V	0.645	0.47
52_F	112_G	0.642	0.47
86_Y	93_W	0.642	0.47
96_F	118_P	0.632	0.46
78_V	130_I	0.630	0.46
122_E	130_I	0.629	0.45
61_V	77_A	0.625	0.45
17_A	82_Q	0.619	0.44
133_L	136_L	0.617	0.44
18_L	58_M	0.614	0.44
20_H	62_S	0.613	0.44
76_R	113_T	0.607	0.43
53_A	90_D	0.604	0.43
104_I	107_D	0.598	0.42
35_A	75_F	0.597	0.42
78_V	116_R	0.593	0.42
37_I	41_Y	0.578	0.40
27_A	81_R	0.578	0.40
114_E	129_K	0.576	0.40
85_P	90_D	0.575	0.40
62_S	74_K	0.575	0.40
123_A	133_L	0.574	0.40
130_I	133_L	0.572	0.40
54_N	82_Q	0.569	0.39
89_P	125_E	0.568	0.39
26_V	32_G	0.567	0.39
32_G	127_W	0.564	0.39
24_V	37_I	0.564	0.39
81_R	88_R	0.564	0.39
119_I	124_A	0.563	0.39
21_Y	65_K	0.555	0.38
20_H	83_R	0.553	0.38
45_G	48_R	0.550	0.37
35_A	103_I	0.549	0.37
105_N	129_K	0.548	0.37
89_P	92_T	0.548	0.37
55_I	82_Q	0.548	0.37
76_R	108_G	0.547	0.37
121_R	127_W	0.537	0.36
62_S	107_D	0.537	0.36
32_G	35_A	0.535	0.36
71_R	124_A	0.534	0.36
22_S	84_M	0.533	0.36
48_R	57_D	0.532	0.36
36_M	138_V	0.528	0.35
75_F	104_I	0.527	0.35
96_F	120_A	0.524	0.35
42_G	48_R	0.523	0.35
93_W	120_A	0.519	0.34
21_Y	60_M	0.517	0.34
19_Q	138_V	0.512	0.34
26_V	63_I	0.510	0.34
33_K	93_W	0.509	0.33
100_A	111_K	0.505	0.33
37_I	101_V	0.504	0.33
121_R	136_L	0.503	0.33
132_S	136_L	0.501	0.33
25_N	83_R	0.501	0.33
95_S	134_A	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j21J	1	0.9493	100	0.084	Contact Map
1vq8K	1	0.9565	100	0.095	Contact Map
3zf7W	1	0.9928	100	0.103	Contact Map
1vx7M	1	0.9565	100	0.121	Contact Map
4ujrI	1	0.9855	100	0.121	Contact Map
3bboM	1	0.8551	100	0.154	Contact Map
1whiA	2	0.8551	100	0.159	Contact Map
4rb6O	1	0.8551	100	0.161	Contact Map
4tp9K	1	0.8478	100	0.174	Contact Map
1vw4I	1	0.8406	100	0.183	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.