RL24 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL24 - 50S ribosomal protein L24P

UniProt:	Q9UX95	Sequences: MVSLKPSKQRKLLYTLPLHQRKKLLVAKVSDDIASQYGIKRIRVRKGDTVRVMRGGNSGKEGKVVEVNTKTGRLAIEGITRKKVDGTPVYVWIHASKVMITKLDLSDPRRREKLEKSKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	119 (114)
Sequences:	494 (286)
Seq/√Len:	26.8

HALSA - RL24
SULSO - RL24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_L	98_V	6.995	1.00
53_M	99_M	3.402	1.00
39_I	114_L	2.801	1.00
34_A	40_K	2.338	0.98
24_L	72_G	2.268	0.98
42_I	100_I	2.239	0.98
3_S	9_Q	2.223	0.98
113_K	116_K	2.219	0.98
64_V	74_L	2.060	0.96
28_K	98_V	1.987	0.96
17_P	20_Q	1.892	0.94
75_A	92_W	1.796	0.93
79_I	91_V	1.768	0.92
18_L	22_K	1.721	0.91
6_P	13_L	1.629	0.88
54_R	59_G	1.616	0.88
28_K	53_M	1.612	0.88
22_K	69_T	1.580	0.87
29_V	33_I	1.575	0.86
52_V	79_I	1.485	0.83
65_V	75_A	1.463	0.82
76_I	79_I	1.433	0.81
6_P	10_R	1.430	0.81
6_P	14_Y	1.416	0.80
25_L	43_R	1.390	0.79
20_Q	59_G	1.370	0.78
36_Q	39_I	1.370	0.78
34_A	59_G	1.369	0.78
57_N	60_K	1.367	0.77
15_T	115_E	1.361	0.77
23_K	70_K	1.330	0.75
83_K	86_G	1.325	0.75
39_I	42_I	1.282	0.73
42_I	103_L	1.262	0.71
38_G	114_L	1.247	0.71
48_D	110_R	1.243	0.70
44_V	74_L	1.229	0.69
40_K	97_K	1.226	0.69
63_K	77_E	1.184	0.66
85_D	104_D	1.170	0.65
13_L	24_L	1.170	0.65
80_T	111_R	1.167	0.65
52_V	76_I	1.164	0.65
21_R	110_R	1.163	0.65
25_L	69_T	1.159	0.65
23_K	117_S	1.152	0.64
43_R	72_G	1.126	0.62
10_R	110_R	1.120	0.62
31_D	44_V	1.114	0.62
57_N	91_V	1.112	0.61
61_E	101_T	1.110	0.61
42_I	114_L	1.109	0.61
44_V	72_G	1.070	0.58
105_L	114_L	1.063	0.58
111_R	117_S	1.063	0.58
71_T	108_P	1.059	0.58
20_Q	23_K	1.049	0.57
105_L	109_R	1.020	0.55
80_T	90_Y	1.003	0.53
56_G	60_K	0.975	0.51
55_G	62_G	0.967	0.51
3_S	102_K	0.954	0.50
18_L	69_T	0.950	0.50
100_I	116_K	0.945	0.49
51_R	99_M	0.919	0.47
36_Q	108_P	0.919	0.47
55_G	67_V	0.918	0.47
54_R	107_D	0.911	0.47
73_R	94_H	0.909	0.46
25_L	72_G	0.898	0.46
31_D	83_K	0.895	0.45
49_T	101_T	0.875	0.44
68_N	71_T	0.871	0.44
3_S	64_V	0.870	0.44
26_V	43_R	0.867	0.43
37_Y	114_L	0.856	0.43
63_K	108_P	0.852	0.42
27_A	102_K	0.847	0.42
42_I	113_K	0.839	0.41
34_A	90_Y	0.829	0.41
26_V	41_R	0.829	0.41
25_L	74_L	0.811	0.39
47_G	88_P	0.810	0.39
99_M	107_D	0.802	0.39
52_V	57_N	0.801	0.39
37_Y	101_T	0.797	0.38
81_R	91_V	0.794	0.38
48_D	64_V	0.781	0.37
47_G	68_N	0.781	0.37
105_L	111_R	0.779	0.37
32_D	113_K	0.779	0.37
6_P	15_T	0.775	0.37
59_G	113_K	0.762	0.36
17_P	21_R	0.760	0.36
31_D	57_N	0.757	0.35
52_V	93_I	0.756	0.35
31_D	36_Q	0.752	0.35
78_G	112_E	0.747	0.35
37_Y	77_E	0.745	0.35
31_D	84_V	0.744	0.35
51_R	59_G	0.742	0.34
43_R	114_L	0.738	0.34
3_S	77_E	0.735	0.34
43_R	58_S	0.732	0.34
38_G	46_K	0.731	0.34
39_I	100_I	0.727	0.33
47_G	66_E	0.719	0.33
43_R	113_K	0.717	0.33
46_K	74_L	0.715	0.33
28_K	97_K	0.712	0.32
26_V	40_K	0.701	0.32
31_D	100_I	0.700	0.32
5_K	69_T	0.699	0.32
71_T	83_K	0.697	0.31
27_A	98_V	0.695	0.31
65_V	90_Y	0.680	0.30
39_I	43_R	0.678	0.30
54_R	110_R	0.678	0.30
9_Q	19_H	0.673	0.30
49_T	85_D	0.666	0.29
98_V	104_D	0.666	0.29
28_K	40_K	0.665	0.29
11_K	15_T	0.664	0.29
61_E	112_E	0.662	0.29
60_K	105_L	0.661	0.29
51_R	78_G	0.648	0.28
77_E	82_K	0.646	0.28
84_V	97_K	0.645	0.28
26_V	97_K	0.645	0.28
54_R	97_K	0.645	0.28
6_P	9_Q	0.639	0.28
68_N	92_W	0.637	0.28
103_L	107_D	0.636	0.28
25_L	29_V	0.629	0.27
56_G	90_Y	0.628	0.27
45_R	116_K	0.627	0.27
66_E	97_K	0.625	0.27
30_S	33_I	0.617	0.27
62_G	76_I	0.616	0.26
25_L	95_A	0.611	0.26
60_K	79_I	0.608	0.26
16_L	82_K	0.597	0.25
56_G	91_V	0.591	0.25
70_K	104_D	0.587	0.25
23_K	67_V	0.587	0.25
30_S	91_V	0.579	0.24
5_K	92_W	0.579	0.24
43_R	69_T	0.576	0.24
40_K	114_L	0.571	0.24
50_V	77_E	0.562	0.23
55_G	110_R	0.557	0.23
27_A	46_K	0.554	0.23
42_I	91_V	0.553	0.23
36_Q	93_I	0.550	0.23
104_D	115_E	0.546	0.23
49_T	69_T	0.543	0.22
16_L	20_Q	0.543	0.22
52_V	91_V	0.542	0.22
23_K	57_N	0.541	0.22
52_V	115_E	0.537	0.22
3_S	46_K	0.528	0.22
10_R	21_R	0.525	0.22
49_T	102_K	0.522	0.21
54_R	61_E	0.517	0.21
47_G	56_G	0.516	0.21
85_D	88_P	0.516	0.21
15_T	19_H	0.513	0.21
46_K	111_R	0.512	0.21
29_V	32_D	0.508	0.21
112_E	115_E	0.502	0.20
25_L	67_V	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ujrL	1	0.9916	100	0.226	Contact Map
3j61Y	1	0.9916	100	0.226	Contact Map
3zf7Z	1	0.9916	100	0.23	Contact Map
4w20Y	1	0.9916	100	0.23	Contact Map
4a17S	1	0.9916	100	0.233	Contact Map
1vx7Z	1	0.9832	100	0.233	Contact Map
3j21U	1	1	100	0.243	Contact Map
1vq8T	1	0.9832	100	0.259	Contact Map
3j7yV	1	0.9076	99.9	0.486	Contact Map
3bboW	1	0.6387	99.9	0.509	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.