RS8 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS8 - 30S ribosomal protein S8

UniProt:	Q9UX92	Sequences: MVFVNPLANALTSIYNNEMRRNKQAIIMPASKLVINVLRVMQKEGYVGEFEYIDDGRWGKITVQLLGRVNKCGPITPRYPLSYRQMIALPDYVRRYLPSKEIGIIIVSTSKGVMSHKEAARLRIGGVALGYVY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (129)
Sequences:	2877 (1350)
Seq/√Len:	118.9

ECOLI - RS8
BACSU - RS8
HALSA - RS8
SULSO - RS8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
111_K	122_L	3.727	1.00
42_Q	49_E	3.517	1.00
12_T	15_Y	3.112	1.00
92_Y	123_R	3.111	1.00
39_R	43_K	2.778	1.00
36_N	39_R	2.750	1.00
26_I	62_T	2.634	1.00
43_K	118_E	2.532	1.00
118_E	122_L	2.515	1.00
10_A	38_L	2.498	1.00
77_P	133_Y	2.310	1.00
116_H	120_A	2.259	1.00
7_L	37_V	2.120	1.00
18_E	73_G	2.120	1.00
9_N	13_S	2.016	1.00
11_L	130_G	2.013	1.00
38_L	63_V	1.851	1.00
53_I	62_T	1.840	1.00
35_I	52_Y	1.815	1.00
6_P	34_V	1.800	1.00
54_D	59_G	1.793	1.00
47_V	50_F	1.771	1.00
24_Q	62_T	1.737	1.00
26_I	60_K	1.708	1.00
10_A	27_I	1.611	1.00
17_N	25_A	1.598	1.00
91_D	94_R	1.548	1.00
42_Q	47_V	1.467	1.00
40_V	113_V	1.461	1.00
33_L	129_L	1.456	1.00
118_E	121_R	1.413	1.00
41_M	132_V	1.370	1.00
39_R	50_F	1.358	1.00
30_A	35_I	1.355	1.00
5_N	80_P	1.341	1.00
105_I	131_Y	1.331	1.00
79_Y	131_Y	1.325	1.00
37_V	113_V	1.309	1.00
86_M	131_Y	1.294	1.00
31_S	34_V	1.293	1.00
7_L	33_L	1.291	1.00
27_I	61_I	1.287	1.00
98_P	105_I	1.260	0.99
95_R	116_H	1.258	0.99
51_E	62_T	1.234	0.99
68_R	72_C	1.233	0.99
90_P	95_R	1.219	0.99
24_Q	64_Q	1.184	0.99
35_I	61_I	1.160	0.99
68_R	73_G	1.146	0.99
21_R	71_K	1.142	0.99
51_E	64_Q	1.115	0.99
30_A	52_Y	1.104	0.99
39_R	42_Q	1.065	0.98
35_I	39_R	1.056	0.98
30_A	59_G	1.049	0.98
55_D	59_G	1.034	0.98
111_K	124_I	1.030	0.98
10_A	34_V	1.019	0.98
54_D	57_R	1.019	0.98
42_Q	50_F	1.019	0.98
77_P	131_Y	1.005	0.97
27_I	63_V	1.005	0.97
95_R	107_V	1.001	0.97
57_R	60_K	0.997	0.97
82_S	89_L	0.993	0.97
77_P	99_S	0.993	0.97
46_Y	104_I	0.982	0.97
90_P	107_V	0.980	0.97
6_P	31_S	0.973	0.97
33_L	113_V	0.953	0.96
18_E	133_Y	0.942	0.96
95_R	128_A	0.934	0.96
106_I	130_G	0.930	0.96
52_Y	59_G	0.925	0.96
97_L	116_H	0.915	0.95
29_P	34_V	0.914	0.95
35_I	59_G	0.881	0.94
81_L	88_A	0.873	0.94
17_N	20_R	0.866	0.94
80_P	87_I	0.865	0.94
114_M	122_L	0.849	0.93
26_I	53_I	0.844	0.93
48_G	64_Q	0.844	0.93
55_D	60_K	0.839	0.93
18_E	68_R	0.839	0.93
90_P	94_R	0.828	0.92
108_S	127_V	0.821	0.92
105_I	116_H	0.820	0.92
32_K	35_I	0.797	0.91
114_M	118_E	0.796	0.91
11_L	15_Y	0.783	0.90
96_Y	105_I	0.781	0.90
10_A	37_V	0.778	0.90
90_P	128_A	0.772	0.89
53_I	57_R	0.768	0.89
45_G	66_L	0.768	0.89
49_E	64_Q	0.764	0.89
53_I	60_K	0.761	0.89
7_L	133_Y	0.756	0.88
67_G	73_G	0.753	0.88
101_E	116_H	0.748	0.88
21_R	73_G	0.748	0.88
128_A	131_Y	0.747	0.88
8_A	34_V	0.746	0.88
111_K	114_M	0.739	0.87
113_V	129_L	0.731	0.87
83_Y	89_L	0.731	0.87
99_S	133_Y	0.731	0.87
66_L	75_I	0.729	0.87
44_E	118_E	0.726	0.86
55_D	58_W	0.724	0.86
43_K	114_M	0.723	0.86
35_I	42_Q	0.698	0.84
13_S	17_N	0.695	0.84
114_M	124_I	0.694	0.84
18_E	78_R	0.684	0.83
14_I	78_R	0.678	0.82
96_Y	131_Y	0.677	0.82
54_D	58_W	0.672	0.82
38_L	61_I	0.670	0.82
86_M	90_P	0.668	0.81
4_V	8_A	0.665	0.81
82_S	127_V	0.662	0.81
68_R	71_K	0.656	0.80
104_I	132_V	0.647	0.79
37_V	130_G	0.647	0.79
114_M	119_A	0.639	0.79
46_Y	102_I	0.634	0.78
98_P	131_Y	0.633	0.78
13_S	22_N	0.631	0.78
35_I	50_F	0.627	0.77
37_V	106_I	0.626	0.77
41_M	106_I	0.625	0.77
14_I	75_I	0.623	0.77
72_C	76_T	0.618	0.76
77_P	86_M	0.617	0.76
40_V	130_G	0.616	0.76
86_M	117_K	0.616	0.76
23_K	48_G	0.616	0.76
24_Q	51_E	0.615	0.76
40_V	106_I	0.615	0.76
40_V	104_I	0.607	0.75
96_Y	120_A	0.606	0.75
56_G	59_G	0.606	0.75
109_T	114_M	0.603	0.74
87_I	127_V	0.603	0.74
85_Q	127_V	0.601	0.74
44_E	115_S	0.600	0.74
27_I	34_V	0.599	0.74
109_T	112_G	0.595	0.73
90_P	133_Y	0.594	0.73
8_A	12_T	0.592	0.73
24_Q	48_G	0.582	0.72
6_P	113_V	0.581	0.72
23_K	121_R	0.579	0.71
98_P	104_I	0.579	0.71
14_I	63_V	0.577	0.71
23_K	68_R	0.577	0.71
76_T	99_S	0.566	0.70
82_S	85_Q	0.564	0.69
22_N	25_A	0.562	0.69
71_K	86_M	0.561	0.69
10_A	63_V	0.560	0.69
45_G	49_E	0.560	0.69
33_L	38_L	0.558	0.69
108_S	113_V	0.557	0.69
48_G	88_A	0.557	0.69
38_L	52_Y	0.556	0.68
41_M	104_I	0.556	0.68
43_K	121_R	0.550	0.68
32_K	59_G	0.549	0.67
107_V	128_A	0.546	0.67
97_L	120_A	0.541	0.66
4_V	13_S	0.540	0.66
50_F	63_V	0.536	0.66
52_Y	61_I	0.534	0.65
68_R	76_T	0.526	0.64
110_S	124_I	0.526	0.64
46_Y	54_D	0.523	0.64
81_L	131_Y	0.521	0.63
36_N	51_E	0.519	0.63
77_P	130_G	0.519	0.63
10_A	88_A	0.516	0.63
20_R	38_L	0.512	0.62
18_E	74_P	0.511	0.62
4_V	34_V	0.510	0.62
15_Y	78_R	0.510	0.62
5_N	8_A	0.509	0.62
93_V	110_S	0.505	0.61
67_G	75_I	0.504	0.61
99_S	117_K	0.502	0.61
7_L	36_N	0.501	0.60
53_I	56_G	0.500	0.60

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pdbA	1	0.9699	100	0.05	Contact Map
4rb5H	1	0.9774	100	0.071	Contact Map
1seiA	2	0.9774	100	0.081	Contact Map
3bbnH	1	0.985	100	0.099	Contact Map
1s03H	1	0.9549	100	0.103	Contact Map
3rf2A	1	0.9699	100	0.112	Contact Map
1i6uA	1	0.9323	100	0.172	Contact Map
4bpeH	1	0.9248	100	0.185	Contact Map
4ujpX	1	0.9248	100	0.213	Contact Map
3qd7X	1	0.4962	52.5	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.