RL6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL6 - 50S ribosomal protein L6

UniProt:	Q9UX91	Sequences: MQIVILREEIEIPKNVVVDLKGSIIKIKGPKGEVVKDFSFAKGIQISLDGNKIVLETTFANRRKKAVFYSIVSHIKNMITGVTKGYRYYLKIIYTHFPTSVKVVGNEVQITNLIGEKNTRRAQILEGVKVTVKGEDIVVEGPNLEAVAQTAANIESASKISGFDRRIFSDGIFIYKKEVIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	181 (171)
Sequences:	3819 (2157)
Seq/√Len:	165.0

ECOLI - RL6
BACSU - RL6
HALSA - RL6
SULSO - RL6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_T	84_K	3.131	1.00
76_K	80_T	2.994	1.00
124_I	130_V	2.602	1.00
28_K	33_E	2.577	1.00
131_T	140_E	2.484	1.00
47_S	56_E	2.435	1.00
87_R	140_E	2.362	1.00
107_E	123_Q	2.243	1.00
89_Y	168_F	2.148	1.00
133_K	136_D	2.109	1.00
107_E	121_R	2.101	1.00
17_V	28_K	2.070	1.00
114_I	157_A	2.049	1.00
149_Q	153_N	2.046	1.00
55_L	75_I	2.046	1.00
166_R	172_I	2.043	1.00
59_F	64_K	2.030	1.00
26_K	33_E	1.885	1.00
139_V	147_V	1.885	1.00
93_I	166_R	1.858	1.00
36_K	145_E	1.832	1.00
122_A	150_T	1.782	1.00
141_G	147_V	1.759	1.00
103_V	132_V	1.734	1.00
24_I	35_V	1.732	1.00
129_K	140_E	1.713	1.00
89_Y	138_V	1.690	1.00
122_A	157_A	1.690	1.00
143_N	146_A	1.611	1.00
41_A	64_K	1.600	1.00
24_I	37_D	1.592	1.00
36_K	78_M	1.587	1.00
89_Y	136_D	1.570	1.00
57_T	68_F	1.538	1.00
45_Q	56_E	1.525	1.00
110_I	114_I	1.520	1.00
20_L	25_I	1.510	1.00
26_K	35_V	1.499	1.00
103_V	124_I	1.487	1.00
106_N	126_E	1.483	1.00
109_Q	121_R	1.477	1.00
104_V	109_Q	1.456	1.00
91_K	169_S	1.456	1.00
11_E	52_K	1.454	1.00
104_V	107_E	1.446	1.00
48_L	53_I	1.393	1.00
114_I	165_R	1.387	1.00
12_I	18_V	1.365	1.00
127_G	146_A	1.351	1.00
176_K	179_V	1.344	1.00
120_R	157_A	1.343	1.00
29_G	32_G	1.322	1.00
45_Q	58_T	1.316	1.00
136_D	168_F	1.314	1.00
122_A	153_N	1.308	1.00
25_I	75_I	1.301	1.00
36_K	74_H	1.300	1.00
70_S	74_H	1.291	1.00
84_K	87_R	1.259	1.00
12_I	48_L	1.252	1.00
31_K	142_P	1.248	1.00
130_V	150_T	1.225	1.00
128_V	150_T	1.212	1.00
106_N	123_Q	1.195	1.00
20_L	48_L	1.194	1.00
67_V	71_I	1.193	1.00
57_T	65_K	1.175	1.00
63_R	66_A	1.173	1.00
116_E	120_R	1.170	1.00
11_E	51_N	1.164	1.00
92_I	101_V	1.140	1.00
131_T	138_V	1.140	1.00
27_I	78_M	1.128	1.00
91_K	168_F	1.123	1.00
38_F	46_I	1.110	1.00
70_S	73_S	1.109	1.00
110_I	157_A	1.101	1.00
47_S	54_V	1.094	1.00
156_S	159_K	1.089	1.00
6_L	68_F	1.086	1.00
155_E	170_D	1.080	1.00
166_R	174_I	1.072	0.99
61_N	64_K	1.071	0.99
150_T	154_I	1.066	0.99
31_K	140_E	1.063	0.99
102_K	109_Q	1.052	0.99
101_V	110_I	1.051	0.99
145_E	149_Q	1.042	0.99
130_V	139_V	1.041	0.99
19_D	26_K	1.035	0.99
58_T	64_K	1.034	0.99
72_V	76_K	1.029	0.99
23_S	37_D	1.022	0.99
53_I	75_I	1.019	0.99
109_Q	119_T	1.016	0.99
108_V	130_V	1.007	0.99
91_K	136_D	1.002	0.99
22_G	37_D	0.995	0.99
44_I	58_T	0.994	0.99
21_K	24_I	0.987	0.99
124_I	150_T	0.984	0.99
17_V	33_E	0.982	0.99
87_R	138_V	0.972	0.99
102_K	111_T	0.971	0.99
146_A	150_T	0.951	0.99
116_E	157_A	0.950	0.99
101_V	137_I	0.947	0.99
44_I	64_K	0.944	0.99
93_I	172_I	0.940	0.99
108_V	154_I	0.925	0.98
57_T	60_A	0.923	0.98
122_A	130_V	0.923	0.98
104_V	121_R	0.917	0.98
18_V	53_I	0.917	0.98
111_T	119_T	0.908	0.98
139_V	154_I	0.905	0.98
103_V	130_V	0.900	0.98
107_E	124_I	0.887	0.98
124_I	139_V	0.887	0.98
34_V	78_M	0.879	0.98
36_K	71_I	0.876	0.98
41_A	59_F	0.874	0.98
91_K	166_R	0.874	0.98
66_A	73_S	0.874	0.98
29_G	82_V	0.870	0.98
32_G	82_V	0.866	0.98
39_S	67_V	0.863	0.98
14_K	51_N	0.862	0.98
149_Q	156_S	0.861	0.98
155_E	167_I	0.856	0.97
31_K	85_G	0.849	0.97
126_E	146_A	0.848	0.97
128_V	141_G	0.844	0.97
97_F	158_S	0.830	0.97
106_N	129_K	0.821	0.97
127_G	141_G	0.818	0.97
41_A	63_R	0.804	0.96
125_L	146_A	0.802	0.96
27_I	83_T	0.800	0.96
63_R	67_V	0.790	0.96
49_D	52_K	0.788	0.96
88_Y	169_S	0.786	0.96
116_E	158_S	0.783	0.96
31_K	129_K	0.780	0.96
8_E	72_V	0.777	0.96
3_I	6_L	0.768	0.95
114_I	118_N	0.766	0.95
65_K	68_F	0.762	0.95
100_S	134_G	0.760	0.95
151_A	167_I	0.757	0.95
12_I	53_I	0.749	0.95
66_A	70_S	0.748	0.95
68_F	179_V	0.742	0.94
16_V	83_T	0.740	0.94
19_D	28_K	0.737	0.94
90_L	137_I	0.736	0.94
103_V	131_T	0.733	0.94
39_S	63_R	0.726	0.94
39_S	71_I	0.724	0.94
49_D	54_V	0.723	0.94
34_V	142_P	0.722	0.93
150_T	153_N	0.719	0.93
44_I	67_V	0.707	0.93
41_A	58_T	0.707	0.93
166_R	169_S	0.702	0.93
13_P	16_V	0.699	0.92
10_I	79_I	0.692	0.92
32_G	142_P	0.687	0.92
38_F	75_I	0.687	0.92
160_I	165_R	0.683	0.91
5_I	73_S	0.679	0.91
100_S	111_T	0.678	0.91
146_A	153_N	0.677	0.91
21_K	26_K	0.676	0.91
92_I	114_I	0.675	0.91
82_V	142_P	0.657	0.90
16_V	82_V	0.656	0.90
128_V	139_V	0.656	0.90
93_I	169_S	0.655	0.90
18_V	27_I	0.655	0.90
9_E	52_K	0.653	0.90
62_R	66_A	0.650	0.89
44_I	55_L	0.650	0.89
55_L	71_I	0.644	0.89
108_V	137_I	0.643	0.89
23_S	45_Q	0.642	0.89
12_I	15_N	0.641	0.89
15_N	30_P	0.640	0.89
174_I	177_K	0.638	0.88
101_V	132_V	0.637	0.88
39_S	44_I	0.636	0.88
167_I	170_D	0.631	0.88
9_E	54_V	0.622	0.87
72_V	79_I	0.622	0.87
160_I	164_D	0.621	0.87
7_R	56_E	0.621	0.87
17_V	48_L	0.621	0.87
88_Y	167_I	0.619	0.87
25_I	48_L	0.614	0.86
73_S	77_N	0.612	0.86
90_L	151_A	0.607	0.86
94_Y	164_D	0.606	0.86
10_I	76_K	0.602	0.85
120_R	165_R	0.602	0.85
9_E	72_V	0.601	0.85
46_I	55_L	0.599	0.85
153_N	157_A	0.594	0.85
116_E	159_K	0.592	0.84
90_L	139_V	0.591	0.84
88_Y	171_G	0.584	0.84
20_L	53_I	0.582	0.83
67_V	70_S	0.579	0.83
175_Y	178_E	0.578	0.83
162_G	174_I	0.578	0.83
150_T	157_A	0.573	0.83
6_L	177_K	0.571	0.82
7_R	65_K	0.569	0.82
124_I	128_V	0.569	0.82
5_I	72_V	0.568	0.82
12_I	79_I	0.557	0.81
166_R	171_G	0.553	0.80
73_S	76_K	0.553	0.80
87_R	168_F	0.552	0.80
86_Y	147_V	0.549	0.80
132_V	137_I	0.548	0.80
147_V	151_A	0.546	0.79
60_A	63_R	0.544	0.79
94_Y	160_I	0.544	0.79
93_I	135_E	0.543	0.79
23_S	58_T	0.540	0.79
76_K	84_K	0.537	0.78
102_K	137_I	0.534	0.78
10_I	72_V	0.533	0.78
34_V	143_N	0.532	0.78
96_H	164_D	0.532	0.78
41_A	67_V	0.527	0.77
27_I	36_K	0.526	0.77
153_N	156_S	0.524	0.77
168_F	171_G	0.524	0.77
6_L	65_K	0.522	0.76
93_I	159_K	0.521	0.76
34_V	82_V	0.519	0.76
158_S	165_R	0.519	0.76
48_L	51_N	0.517	0.76
128_V	146_A	0.516	0.76
108_V	132_V	0.516	0.76
37_D	78_M	0.514	0.75
7_R	57_T	0.513	0.75
25_I	38_F	0.513	0.75
44_I	57_T	0.512	0.75
60_A	68_F	0.511	0.75
19_D	48_L	0.510	0.75
124_I	147_V	0.508	0.74
110_I	137_I	0.505	0.74
20_L	46_I	0.504	0.74
21_K	37_D	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j21F	1	0.9945	100	0.122	Contact Map
1vx7H	1	0.9834	100	0.122	Contact Map
4w20H	1	0.9945	100	0.124	Contact Map
4ujqK	1	0.9945	100	0.124	Contact Map
4a17E	1	0.9945	100	0.127	Contact Map
3j39H	1	0.9834	100	0.13	Contact Map
3zf7y	1	0.989	100	0.132	Contact Map
4tp9G	1	0.9503	100	0.133	Contact Map
1nkwE	1	0.9392	100	0.135	Contact Map
1rl6A	1	0.884	100	0.136	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.