RL32 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL32 - 50S ribosomal protein L32e

UniProt:	Q9UX90	Sequences: MTEGRIQSYRKKIYVIRQKLKAKKPKFLRYDSDKFYRLGRQEKWRRPYGRDNKTRLKVRGFPAIVSVGYRLPKKVRGFHPSGLRQVIVHNVNELVKVQNQKDNVIVTISSSVGFKKRLEILNKARELGLKVSNEGVVT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	138 (121)
Sequences:	537 (314)
Seq/√Len:	28.6

HALSA - RL32
SULSO - RL32

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
106_V	129_L	3.480	1.00
85_Q	107_T	3.413	1.00
105_I	132_S	3.241	1.00
125_R	134_E	2.922	1.00
106_V	131_V	2.613	0.99
131_V	134_E	2.606	0.99
118_L	122_N	2.556	0.99
79_H	85_Q	2.442	0.99
30_Y	52_N	2.287	0.99
122_N	126_E	2.233	0.98
123_K	127_L	2.158	0.98
39_G	42_E	2.086	0.97
79_H	105_I	1.986	0.96
83_L	130_K	1.969	0.96
57_K	66_S	1.934	0.96
108_I	112_V	1.898	0.95
51_D	60_G	1.897	0.95
31_D	35_F	1.846	0.95
39_G	43_K	1.806	0.94
21_K	71_L	1.786	0.94
123_K	126_E	1.759	0.93
88_V	131_V	1.679	0.91
29_R	45_R	1.652	0.91
107_T	132_S	1.638	0.90
47_P	64_I	1.618	0.90
55_R	117_R	1.535	0.87
95_V	123_K	1.535	0.87
119_E	122_N	1.504	0.86
89_H	121_L	1.477	0.85
112_V	120_I	1.446	0.83
32_S	38_L	1.424	0.82
54_T	62_P	1.409	0.82
89_H	93_E	1.376	0.80
28_L	42_E	1.371	0.80
30_Y	48_Y	1.370	0.80
45_R	55_R	1.354	0.79
16_I	20_L	1.320	0.77
90_N	112_V	1.302	0.76
38_L	43_K	1.277	0.75
83_L	125_R	1.255	0.74
13_I	75_V	1.235	0.72
37_R	42_E	1.216	0.71
97_V	129_L	1.215	0.71
71_L	75_V	1.208	0.71
25_P	65_V	1.173	0.68
29_R	55_R	1.170	0.68
38_L	42_E	1.145	0.66
88_V	116_K	1.144	0.66
108_I	120_I	1.132	0.66
105_I	130_K	1.119	0.65
124_A	133_N	1.106	0.64
45_R	49_G	1.102	0.63
90_N	117_R	1.094	0.63
19_K	22_A	1.092	0.63
54_T	64_I	1.087	0.62
36_Y	39_G	1.070	0.61
118_L	128_G	1.066	0.61
44_W	117_R	1.065	0.61
19_K	78_F	1.040	0.59
52_N	61_F	0.983	0.55
91_V	120_I	0.963	0.53
109_S	112_V	0.959	0.53
20_L	75_V	0.958	0.53
94_L	129_L	0.943	0.51
24_K	71_L	0.942	0.51
55_R	68_G	0.934	0.51
91_V	94_L	0.929	0.50
84_R	103_N	0.921	0.50
45_R	133_N	0.907	0.49
81_S	87_I	0.901	0.48
87_I	95_V	0.874	0.46
87_I	132_S	0.861	0.45
51_D	54_T	0.855	0.45
30_Y	37_R	0.854	0.45
120_I	133_N	0.850	0.44
104_V	116_K	0.843	0.44
50_R	60_G	0.834	0.43
21_K	24_K	0.828	0.43
53_K	61_F	0.828	0.43
85_Q	132_S	0.824	0.42
121_L	131_V	0.824	0.42
70_R	88_V	0.823	0.42
33_D	51_D	0.818	0.42
115_K	119_E	0.815	0.42
90_N	93_E	0.813	0.41
86_V	104_V	0.805	0.41
26_K	30_Y	0.796	0.40
23_K	91_V	0.792	0.40
45_R	117_R	0.791	0.40
57_K	64_I	0.781	0.39
104_V	115_K	0.780	0.39
112_V	117_R	0.778	0.39
46_R	61_F	0.769	0.38
88_V	133_N	0.764	0.38
35_F	38_L	0.759	0.37
72_P	77_G	0.755	0.37
89_H	131_V	0.751	0.37
62_P	103_N	0.749	0.37
83_L	105_I	0.741	0.36
93_E	97_V	0.738	0.36
13_I	16_I	0.738	0.36
107_T	110_S	0.735	0.36
50_R	54_T	0.733	0.36
37_R	100_Q	0.732	0.36
63_A	69_Y	0.731	0.35
17_R	78_F	0.731	0.35
19_K	71_L	0.730	0.35
28_L	32_S	0.725	0.35
59_R	89_H	0.722	0.35
19_K	75_V	0.718	0.35
33_D	60_G	0.716	0.34
78_F	115_K	0.715	0.34
20_L	93_E	0.714	0.34
88_V	108_I	0.707	0.34
73_K	111_S	0.699	0.33
97_V	110_S	0.697	0.33
47_P	68_G	0.697	0.33
95_V	126_E	0.691	0.33
54_T	90_N	0.690	0.33
90_N	109_S	0.686	0.32
106_V	127_L	0.684	0.32
81_S	105_I	0.668	0.31
84_R	100_Q	0.659	0.31
17_R	72_P	0.654	0.30
98_Q	113_G	0.651	0.30
31_D	34_K	0.648	0.30
53_K	58_V	0.646	0.30
45_R	76_R	0.646	0.30
79_H	130_K	0.643	0.30
46_R	118_L	0.635	0.29
30_Y	35_F	0.635	0.29
20_L	24_K	0.628	0.29
86_V	115_K	0.623	0.28
19_K	23_K	0.621	0.28
13_I	20_L	0.618	0.28
77_G	104_V	0.610	0.27
45_R	120_I	0.610	0.27
32_S	64_I	0.606	0.27
102_D	107_T	0.605	0.27
34_K	39_G	0.595	0.27
36_Y	118_L	0.593	0.26
64_I	69_Y	0.592	0.26
50_R	56_L	0.585	0.26
15_V	18_Q	0.584	0.26
36_Y	52_N	0.580	0.26
44_W	47_P	0.579	0.26
89_H	114_F	0.577	0.25
76_R	119_E	0.575	0.25
43_K	76_R	0.570	0.25
31_D	99_N	0.570	0.25
35_F	125_R	0.568	0.25
33_D	58_V	0.568	0.25
57_K	60_G	0.560	0.24
49_G	55_R	0.560	0.24
99_N	107_T	0.552	0.24
96_K	100_Q	0.551	0.24
51_D	57_K	0.547	0.24
29_R	52_N	0.541	0.23
60_G	121_L	0.539	0.23
35_F	46_R	0.536	0.23
29_R	133_N	0.535	0.23
97_V	112_V	0.534	0.23
14_Y	22_A	0.525	0.23
45_R	84_R	0.524	0.22
14_Y	80_P	0.523	0.22
108_I	116_K	0.517	0.22
37_R	78_F	0.516	0.22
48_Y	54_T	0.515	0.22
78_F	84_R	0.514	0.22
100_Q	114_F	0.514	0.22
29_R	129_L	0.512	0.22
121_L	129_L	0.512	0.22
72_P	113_G	0.511	0.22
17_R	25_P	0.510	0.22
92_N	95_V	0.510	0.22
63_A	105_I	0.510	0.22
87_I	92_N	0.510	0.22
45_R	116_K	0.508	0.22
94_L	104_V	0.507	0.22
79_H	103_N	0.504	0.21
20_L	56_L	0.502	0.21
32_S	43_K	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zf7i	1	0.913	100	0.085	Contact Map
4a17X	1	0.9058	100	0.086	Contact Map
4w20e	1	0.9275	100	0.087	Contact Map
3j61e	1	0.9203	100	0.088	Contact Map
1vx78	1	0.9058	100	0.093	Contact Map
4ujrR	1	0.9058	100	0.096	Contact Map
3j21b	1	0.9203	100	0.115	Contact Map
1vq8Y	1	0.9565	100	0.151	Contact Map
4o5aA	2	0.0072	31.8	0.941	Contact Map
3h5tA	2	0.3406	31.1	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.