RL19E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL19E - 50S ribosomal protein L19e

UniProt:	Q9UX89	Sequences: MTNLKAQKRLAASIAGVGINRIKVVEDYIEDVQSSLTRDEIRNLIKDGKIIVLKKVGISGGRLKERRKKRSLKSEGKKSGSRKGKKGARANSKQMWVKRVRKIRAYLKWLRDHKVIDRHTYRELYLKTKGGNYKGVSDVRNVLIQMGKIKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	151 (142)
Sequences:	391 (237)
Seq/√Len:	19.9

HALSA - RL19E
SULSO - RL19E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_V	32_V	5.811	1.00
100_V	128_T	5.159	1.00
60_G	64_K	4.079	1.00
87_G	92_S	3.621	1.00
8_K	19_I	3.032	0.99
124_L	142_V	2.916	0.99
28_Y	49_K	2.453	0.97
14_I	45_I	2.399	0.96
60_G	63_L	2.347	0.96
94_Q	97_V	2.331	0.96
69_K	76_G	2.255	0.95
39_D	42_R	2.201	0.94
4_L	38_R	2.140	0.93
117_D	120_T	2.047	0.92
59_S	62_R	2.001	0.91
69_K	75_E	1.985	0.90
89_R	104_R	1.894	0.88
15_A	52_V	1.868	0.87
6_A	10_L	1.832	0.86
106_Y	140_R	1.825	0.86
74_S	133_Y	1.717	0.82
32_V	44_L	1.647	0.80
38_R	104_R	1.620	0.78
134_K	138_D	1.514	0.73
127_K	132_N	1.512	0.73
23_K	51_I	1.508	0.73
22_I	98_K	1.482	0.72
61_G	65_E	1.410	0.68
65_E	69_K	1.406	0.68
103_I	139_V	1.390	0.67
100_V	122_R	1.371	0.66
8_K	79_S	1.366	0.65
47_D	51_I	1.352	0.65
9_R	13_S	1.334	0.64
35_S	112_D	1.324	0.63
42_R	62_R	1.322	0.63
127_K	135_G	1.297	0.61
7_Q	111_R	1.291	0.61
109_W	115_V	1.291	0.61
22_I	45_I	1.257	0.59
15_A	45_I	1.234	0.57
21_R	55_K	1.219	0.56
30_E	37_T	1.209	0.56
10_L	14_I	1.208	0.56
7_Q	32_V	1.202	0.55
3_N	6_A	1.200	0.55
50_I	107_L	1.189	0.54
86_K	114_K	1.179	0.54
56_V	123_E	1.108	0.49
15_A	78_K	1.104	0.49
111_R	128_T	1.091	0.48
34_S	142_V	1.057	0.46
80_G	84_G	1.053	0.46
110_L	143_L	1.045	0.45
78_K	104_R	1.039	0.45
17_V	124_L	1.032	0.44
89_R	130_G	1.016	0.43
3_N	16_G	1.013	0.43
90_A	95_M	1.009	0.43
95_M	99_R	1.009	0.43
103_I	143_L	0.999	0.42
57_G	114_K	0.998	0.42
82_R	111_R	0.995	0.42
117_D	124_L	0.978	0.41
123_E	127_K	0.975	0.41
31_D	83_K	0.968	0.40
81_S	92_S	0.958	0.40
38_R	111_R	0.948	0.39
39_D	110_L	0.945	0.39
8_K	38_R	0.911	0.37
42_R	48_G	0.904	0.36
10_L	117_D	0.902	0.36
15_A	66_R	0.901	0.36
67_R	108_K	0.894	0.36
84_G	104_R	0.894	0.36
9_R	18_G	0.893	0.36
14_I	32_V	0.891	0.36
77_K	87_G	0.890	0.36
17_V	98_K	0.890	0.36
136_V	144_I	0.889	0.36
34_S	40_E	0.884	0.35
103_I	136_V	0.883	0.35
137_S	140_R	0.875	0.35
7_Q	35_S	0.861	0.34
36_L	75_E	0.861	0.34
46_K	93_K	0.855	0.34
25_V	69_K	0.851	0.33
22_I	52_V	0.846	0.33
60_G	89_R	0.845	0.33
100_V	140_R	0.845	0.33
11_A	18_G	0.844	0.33
115_V	143_L	0.844	0.33
27_D	124_L	0.839	0.33
96_W	111_R	0.837	0.32
23_K	78_K	0.829	0.32
13_S	119_H	0.827	0.32
26_E	124_L	0.826	0.32
106_Y	109_W	0.822	0.32
81_S	138_D	0.815	0.31
58_I	70_R	0.815	0.31
85_K	116_I	0.810	0.31
16_G	114_K	0.808	0.31
10_L	106_Y	0.808	0.31
93_K	135_G	0.806	0.31
102_K	109_W	0.798	0.30
37_T	116_I	0.790	0.30
57_G	77_K	0.785	0.30
4_L	16_G	0.784	0.30
19_I	123_E	0.784	0.30
75_E	111_R	0.780	0.29
43_N	47_D	0.778	0.29
91_N	98_K	0.771	0.29
39_D	123_E	0.765	0.29
109_W	140_R	0.764	0.28
17_V	52_V	0.760	0.28
124_L	133_Y	0.758	0.28
11_A	82_R	0.754	0.28
136_V	140_R	0.752	0.28
95_M	124_L	0.751	0.28
44_L	49_K	0.751	0.28
138_D	144_I	0.750	0.28
21_R	145_Q	0.738	0.27
28_Y	47_D	0.738	0.27
115_V	134_K	0.736	0.27
47_D	139_V	0.723	0.26
12_A	56_V	0.720	0.26
38_R	61_G	0.720	0.26
7_Q	121_Y	0.712	0.26
28_Y	31_D	0.710	0.26
37_T	110_L	0.709	0.26
46_K	55_K	0.705	0.25
129_K	134_K	0.705	0.25
111_R	125_Y	0.700	0.25
38_R	62_R	0.699	0.25
23_K	130_G	0.695	0.25
42_R	104_R	0.692	0.25
59_S	101_R	0.691	0.25
114_K	118_R	0.690	0.25
103_I	115_V	0.687	0.25
23_K	26_E	0.685	0.25
91_N	97_V	0.683	0.24
17_V	34_S	0.678	0.24
43_N	113_H	0.675	0.24
31_D	46_K	0.675	0.24
69_K	73_K	0.675	0.24
26_E	133_Y	0.671	0.24
4_L	99_R	0.669	0.24
102_K	136_V	0.669	0.24
7_Q	41_I	0.663	0.23
41_I	144_I	0.657	0.23
17_V	22_I	0.657	0.23
77_K	100_V	0.651	0.23
60_G	104_R	0.648	0.23
96_W	129_K	0.644	0.23
20_N	91_N	0.642	0.23
25_V	28_Y	0.642	0.23
73_K	129_K	0.639	0.22
10_L	99_R	0.633	0.22
75_E	139_V	0.629	0.22
10_L	52_V	0.629	0.22
140_R	145_Q	0.625	0.22
4_L	33_Q	0.623	0.22
53_L	115_V	0.618	0.21
24_V	100_V	0.618	0.21
50_I	135_G	0.616	0.21
51_I	69_K	0.614	0.21
39_D	56_V	0.613	0.21
106_Y	136_V	0.612	0.21
20_N	63_L	0.607	0.21
8_K	92_S	0.601	0.21
31_D	48_G	0.598	0.21
3_N	103_I	0.592	0.20
105_A	136_V	0.591	0.20
15_A	74_S	0.590	0.20
88_A	93_K	0.590	0.20
80_G	89_R	0.589	0.20
56_V	86_K	0.585	0.20
43_N	58_I	0.579	0.20
4_L	7_Q	0.577	0.20
126_L	138_D	0.574	0.20
26_E	48_G	0.574	0.20
24_V	43_N	0.570	0.19
21_R	51_I	0.570	0.19
71_S	120_T	0.566	0.19
34_S	37_T	0.563	0.19
10_L	97_V	0.562	0.19
71_S	94_Q	0.561	0.19
57_G	65_E	0.558	0.19
124_L	132_N	0.557	0.19
49_K	86_K	0.555	0.19
22_I	81_S	0.555	0.19
20_N	66_R	0.554	0.19
25_V	75_E	0.554	0.19
3_N	86_K	0.550	0.19
97_V	111_R	0.542	0.18
42_R	134_K	0.540	0.18
65_E	90_A	0.540	0.18
44_L	105_A	0.537	0.18
70_R	75_E	0.534	0.18
78_K	89_R	0.533	0.18
60_G	107_L	0.530	0.18
63_L	67_R	0.529	0.18
23_K	28_Y	0.524	0.18
60_G	90_A	0.519	0.17
47_D	53_L	0.512	0.17
50_I	67_R	0.512	0.17
24_V	29_I	0.511	0.17
73_K	126_L	0.510	0.17
70_R	73_K	0.508	0.17
33_Q	55_K	0.505	0.17
14_I	144_I	0.504	0.17
59_S	84_G	0.503	0.17
45_I	118_R	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zf7T	1	0.9868	100	-0.003	Contact Map
3j61R	1	0.9934	100	-0.001	Contact Map
4a17O	1	0.9669	100	0.002	Contact Map
4w20R	1	0.9868	100	0.002	Contact Map
4a1aO	1	0.9868	100	0.004	Contact Map
1vx7T	1	0.9801	100	0.016	Contact Map
4ujrE	1	0.9868	100	0.017	Contact Map
3j21Q	1	0.9934	100	0.02	Contact Map
1vq8P	1	0.947	100	0.025	Contact Map
3jywP	1	0.9868	100	0.113	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.