RL18 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL18 - 50S ribosomal protein L18

UniProt:	Q9UX88	Sequences: MNKLANGPNYKVKPRRRREGKTNYYKRYVYVISKQTRFIVRITNKYVIVQIAKIDPKGDIMIASAHSAELAKKFGWKGDENNTPAAYLTGYLAGLRAIKRGVTECVADIGLHVPSKGNRVFYVIKGAIDAGLKIPIGDISIENDRIKGEHIAKYAEKLKSENSDLYSKLFSRYLQRGLNPENLPSHFEEILNKIKSSGG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	199 (192)
Sequences:	458 (230)
Seq/√Len:	16.6

HALSA - RL18
SULSO - RL18

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_T	48_I	6.507	1.00
94_G	130_A	4.875	1.00
49_V	123_V	4.418	1.00
52_A	61_M	3.438	0.99
15_R	19_E	3.349	0.99
4_L	8_P	3.167	0.99
76_W	190_I	3.154	0.99
39_I	52_A	3.000	0.98
46_Y	68_A	2.903	0.98
172_R	175_Q	2.797	0.98
144_D	149_E	2.365	0.94
25_Y	28_Y	2.322	0.93
47_V	86_A	2.279	0.92
38_F	127_A	2.058	0.88
49_V	93_A	2.052	0.87
179_N	182_N	2.036	0.87
189_E	193_K	2.031	0.87
114_P	121_F	1.981	0.85
38_F	93_A	1.970	0.85
104_E	133_K	1.961	0.85
46_Y	66_H	1.948	0.84
186_H	190_I	1.900	0.83
107_A	124_I	1.887	0.83
185_S	189_E	1.887	0.83
163_S	167_S	1.881	0.82
122_Y	142_E	1.877	0.82
78_G	186_H	1.844	0.81
132_L	173_Y	1.777	0.78
23_N	26_K	1.765	0.78
62_I	101_G	1.753	0.77
124_I	136_I	1.715	0.76
17_R	27_R	1.630	0.72
89_T	92_L	1.623	0.72
4_L	7_G	1.598	0.70
65_A	69_E	1.596	0.70
67_S	89_T	1.566	0.69
165_L	169_L	1.562	0.69
51_I	132_L	1.527	0.67
127_A	132_L	1.526	0.67
69_E	92_L	1.522	0.67
185_S	196_S	1.512	0.66
46_Y	67_S	1.501	0.65
84_P	151_I	1.493	0.65
40_V	123_V	1.489	0.65
63_A	97_A	1.433	0.62
84_P	105_C	1.425	0.61
38_F	123_V	1.394	0.60
27_R	41_R	1.363	0.58
28_Y	32_I	1.355	0.57
145_R	149_E	1.350	0.57
16_R	22_T	1.349	0.57
191_L	195_K	1.343	0.57
79_D	82_N	1.338	0.56
40_V	49_V	1.328	0.56
65_A	96_R	1.326	0.56
14_P	124_I	1.311	0.55
55_D	60_I	1.305	0.54
25_Y	29_V	1.239	0.50
76_W	88_L	1.237	0.50
124_I	128_I	1.236	0.50
158_L	168_K	1.212	0.49
151_I	165_L	1.203	0.48
156_E	181_E	1.179	0.47
74_F	132_L	1.175	0.47
69_E	96_R	1.168	0.46
6_N	11_K	1.165	0.46
60_I	144_D	1.154	0.45
141_I	144_D	1.151	0.45
68_A	81_N	1.116	0.43
166_Y	180_P	1.112	0.43
109_I	114_P	1.110	0.43
47_V	113_V	1.105	0.43
46_Y	81_N	1.096	0.42
159_K	181_E	1.093	0.42
115_S	118_N	1.090	0.42
50_Q	65_A	1.073	0.41
159_K	166_Y	1.060	0.40
176_R	183_L	1.053	0.40
180_P	196_S	1.046	0.39
149_E	153_K	1.039	0.39
34_K	83_T	1.038	0.39
166_Y	174_L	1.034	0.39
178_L	186_H	1.023	0.38
74_F	190_I	1.021	0.38
79_D	96_R	1.016	0.38
141_I	145_R	1.010	0.37
111_L	121_F	1.002	0.37
178_L	183_L	0.998	0.37
168_K	171_S	0.994	0.36
91_Y	95_L	0.990	0.36
42_I	112_H	0.987	0.36
139_I	193_K	0.982	0.36
35_Q	104_E	0.980	0.36
173_Y	183_L	0.978	0.35
158_L	169_L	0.973	0.35
188_E	192_N	0.968	0.35
143_N	174_L	0.968	0.35
106_V	190_I	0.963	0.35
5_A	99_K	0.951	0.34
26_K	40_V	0.946	0.34
120_V	123_V	0.942	0.34
119_R	164_D	0.937	0.33
84_P	148_G	0.936	0.33
44_N	54_I	0.931	0.33
162_N	165_L	0.931	0.33
22_T	27_R	0.919	0.32
78_G	83_T	0.918	0.32
141_I	156_E	0.913	0.32
76_W	114_P	0.890	0.31
189_E	196_S	0.885	0.31
64_S	100_R	0.884	0.31
151_I	161_E	0.877	0.30
47_V	120_V	0.876	0.30
17_R	41_R	0.875	0.30
153_K	156_E	0.862	0.29
31_V	104_E	0.859	0.29
20_G	40_V	0.857	0.29
172_R	196_S	0.857	0.29
168_K	180_P	0.856	0.29
80_E	94_G	0.856	0.29
166_Y	179_N	0.854	0.29
24_Y	108_D	0.851	0.29
178_L	181_E	0.851	0.29
78_G	88_L	0.849	0.29
119_R	122_Y	0.832	0.28
85_A	89_T	0.825	0.28
83_T	97_A	0.817	0.27
87_Y	90_G	0.817	0.27
92_L	96_R	0.814	0.27
46_Y	61_M	0.812	0.27
38_F	49_V	0.811	0.27
91_Y	94_G	0.800	0.27
104_E	119_R	0.799	0.26
93_A	123_V	0.794	0.26
106_V	150_H	0.790	0.26
93_A	105_C	0.786	0.26
79_D	98_I	0.784	0.26
94_G	98_I	0.781	0.26
42_I	172_R	0.779	0.26
41_R	108_D	0.779	0.26
85_A	96_R	0.779	0.26
181_E	188_E	0.779	0.26
143_N	147_K	0.775	0.25
187_F	190_I	0.773	0.25
76_W	124_I	0.764	0.25
107_A	126_G	0.764	0.25
30_Y	79_D	0.763	0.25
83_T	132_L	0.757	0.25
36_T	53_K	0.757	0.25
152_A	156_E	0.754	0.24
184_P	187_F	0.751	0.24
140_S	144_D	0.750	0.24
76_W	186_H	0.748	0.24
157_K	161_E	0.748	0.24
61_M	164_D	0.746	0.24
57_K	60_I	0.745	0.24
25_Y	175_Q	0.740	0.24
145_R	189_E	0.738	0.24
16_R	27_R	0.735	0.24
107_A	136_I	0.729	0.23
9_N	30_Y	0.728	0.23
15_R	52_A	0.721	0.23
49_V	134_I	0.720	0.23
143_N	146_I	0.720	0.23
41_R	70_L	0.717	0.23
101_G	145_R	0.715	0.23
65_A	92_L	0.713	0.23
175_Q	179_N	0.711	0.23
33_S	36_T	0.707	0.22
184_P	191_L	0.705	0.22
65_A	89_T	0.703	0.22
77_K	177_G	0.701	0.22
8_P	112_H	0.694	0.22
38_F	94_G	0.694	0.22
105_C	132_L	0.693	0.22
15_R	168_K	0.692	0.22
39_I	57_K	0.689	0.22
121_F	137_G	0.689	0.22
41_R	59_D	0.689	0.22
68_A	71_A	0.689	0.22
193_K	196_S	0.688	0.22
171_S	196_S	0.687	0.22
10_Y	15_R	0.682	0.21
28_Y	31_V	0.677	0.21
55_D	106_V	0.677	0.21
53_K	62_I	0.674	0.21
106_V	169_L	0.668	0.21
43_T	63_A	0.668	0.21
42_I	47_V	0.661	0.21
59_D	131_G	0.654	0.20
93_A	128_I	0.647	0.20
89_T	123_V	0.645	0.20
156_E	185_S	0.643	0.20
82_N	92_L	0.633	0.20
102_V	105_C	0.632	0.20
23_N	27_R	0.629	0.19
51_I	93_A	0.625	0.19
157_K	182_N	0.624	0.19
189_E	192_N	0.621	0.19
128_I	133_K	0.619	0.19
65_A	155_A	0.617	0.19
59_D	90_G	0.616	0.19
118_N	124_I	0.615	0.19
66_H	81_N	0.614	0.19
160_S	181_E	0.613	0.19
166_Y	176_R	0.612	0.19
47_V	67_S	0.610	0.19
88_L	106_V	0.610	0.19
154_Y	170_F	0.609	0.19
81_N	91_Y	0.608	0.19
41_R	131_G	0.608	0.19
14_P	188_E	0.607	0.19
7_G	13_K	0.606	0.19
163_S	166_Y	0.606	0.19
105_C	134_I	0.606	0.19
78_G	97_A	0.604	0.19
179_N	190_I	0.603	0.18
31_V	43_T	0.602	0.18
76_W	102_V	0.602	0.18
128_I	190_I	0.602	0.18
145_R	177_G	0.602	0.18
127_A	134_I	0.601	0.18
50_Q	160_S	0.600	0.18
97_A	168_K	0.599	0.18
80_E	98_I	0.594	0.18
30_Y	34_K	0.591	0.18
83_T	88_L	0.585	0.18
156_E	175_Q	0.580	0.18
6_N	23_N	0.579	0.18
165_L	188_E	0.577	0.18
86_A	123_V	0.572	0.17
47_V	105_C	0.569	0.17
45_K	57_K	0.569	0.17
42_I	153_K	0.568	0.17
57_K	128_I	0.566	0.17
182_N	185_S	0.564	0.17
76_W	106_V	0.563	0.17
55_D	168_K	0.562	0.17
51_I	118_N	0.560	0.17
7_G	28_Y	0.560	0.17
82_N	87_Y	0.558	0.17
43_T	81_N	0.558	0.17
25_Y	31_V	0.557	0.17
163_S	179_N	0.556	0.17
39_I	62_I	0.556	0.17
13_K	36_T	0.553	0.17
97_A	101_G	0.552	0.17
35_Q	107_A	0.551	0.17
16_R	108_D	0.550	0.17
42_I	60_I	0.546	0.17
97_A	105_C	0.545	0.16
31_V	192_N	0.545	0.16
69_E	125_K	0.543	0.16
86_A	91_Y	0.541	0.16
30_Y	77_K	0.539	0.16
23_N	30_Y	0.539	0.16
115_S	162_N	0.537	0.16
71_A	116_K	0.536	0.16
21_K	69_E	0.534	0.16
185_S	192_N	0.534	0.16
172_R	178_L	0.533	0.16
125_K	143_N	0.529	0.16
13_K	26_K	0.529	0.16
34_K	151_I	0.528	0.16
12_V	15_R	0.527	0.16
128_I	162_N	0.526	0.16
91_Y	195_K	0.526	0.16
111_L	118_N	0.526	0.16
128_I	169_L	0.524	0.16
60_I	175_Q	0.524	0.16
60_I	145_R	0.520	0.16
22_T	41_R	0.519	0.16
141_I	188_E	0.517	0.16
31_V	54_I	0.517	0.16
4_L	143_N	0.516	0.16
9_N	54_I	0.516	0.16
185_S	188_E	0.508	0.15
79_D	91_Y	0.506	0.15
90_G	131_G	0.506	0.15
98_I	113_V	0.506	0.15
64_S	68_A	0.506	0.15
117_G	121_F	0.504	0.15
89_T	95_L	0.502	0.15
42_I	149_E	0.502	0.15
99_K	171_S	0.502	0.15
161_E	181_E	0.501	0.15
31_V	173_Y	0.500	0.15
151_I	154_Y	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ujqG	1	0.995	100	0.191	Contact Map
3zf7u	1	0.995	100	0.195	Contact Map
3j61D	1	0.9799	100	0.197	Contact Map
4a17M	1	0.995	100	0.204	Contact Map
3j39D	1	0.9899	100	0.205	Contact Map
4w20D	1	0.995	100	0.211	Contact Map
1vx7R	1	0.9899	100	0.215	Contact Map
3j21O	1	0.9849	100	0.252	Contact Map
1vq8N	1	0.9196	100	0.326	Contact Map
1ovyA	1	0.4724	100	0.677	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.