RL30 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL30 - 50S ribosomal protein L30P

UniProt:	Q9UX86	Sequences: MVELLGIIRIRGWAKAPWYINETLNMLRLRYNFNTMVYPKTSQILGMLNKVSPYITWGEIDPDTLKLLIINRLETVKGDKVSDSYVKEVLKIENIDAMVKQLYEGKIYLHKLDEYFKLPIRLHPPRGGFKGSVKRPYKNKGEFGYRGDKINELMRRMV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (152)
Sequences:	687 (421)
Seq/√Len:	34.1

HALSA - RL30
SULSO - RL30

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_G	35_T	6.282	1.00
51_V	55_I	4.535	1.00
4_L	105_G	3.913	1.00
59_E	145_Y	3.628	1.00
64_T	154_M	3.062	1.00
98_M	112_L	3.017	1.00
27_L	51_V	2.993	1.00
108_Y	111_K	2.937	1.00
6_G	154_M	2.870	1.00
75_T	81_V	2.744	1.00
149_K	152_E	2.575	1.00
137_Y	149_K	2.292	0.99
63_D	67_L	2.209	0.99
66_K	96_D	2.146	0.99
77_K	86_V	2.089	0.99
60_I	65_L	1.984	0.98
5_L	40_K	1.982	0.98
33_F	129_F	1.887	0.97
23_T	50_K	1.829	0.97
75_T	116_F	1.814	0.96
56_T	146_R	1.799	0.96
23_T	47_M	1.781	0.96
83_D	95_I	1.746	0.96
84_S	87_K	1.589	0.93
7_I	38_Y	1.501	0.90
20_I	24_L	1.494	0.90
125_P	128_G	1.491	0.90
42_S	46_G	1.473	0.89
62_P	100_K	1.427	0.88
57_W	145_Y	1.388	0.86
16_A	20_I	1.379	0.86
61_D	67_L	1.349	0.85
7_I	153_L	1.339	0.84
33_F	72_R	1.332	0.84
65_L	103_Y	1.289	0.82
49_N	52_S	1.284	0.82
92_I	101_Q	1.279	0.82
153_L	157_M	1.278	0.81
28_R	72_R	1.270	0.81
84_S	97_A	1.269	0.81
22_E	26_M	1.264	0.81
56_T	145_Y	1.220	0.78
17_P	20_I	1.211	0.78
93_E	97_A	1.200	0.77
26_M	47_M	1.198	0.77
85_Y	89_V	1.188	0.76
137_Y	140_K	1.185	0.76
87_K	95_I	1.178	0.76
61_D	155_R	1.159	0.75
40_K	45_L	1.157	0.74
67_L	155_R	1.144	0.74
130_K	142_E	1.138	0.73
62_P	66_K	1.124	0.72
100_K	104_E	1.121	0.72
146_R	151_N	1.118	0.72
69_I	102_L	1.116	0.72
36_M	113_D	1.112	0.71
31_Y	34_N	1.079	0.69
83_D	86_V	1.078	0.69
141_G	144_G	1.070	0.68
25_N	31_Y	1.041	0.66
33_F	126_R	1.038	0.66
84_S	88_E	1.031	0.66
35_T	154_M	1.029	0.65
101_Q	106_K	1.020	0.65
61_D	151_N	1.011	0.64
125_P	129_F	1.007	0.64
33_F	124_P	0.993	0.63
76_V	118_L	0.984	0.62
136_P	139_N	0.976	0.61
114_E	133_V	0.973	0.61
86_V	95_I	0.970	0.61
8_I	154_M	0.968	0.61
81_V	116_F	0.965	0.60
18_W	21_N	0.958	0.60
30_R	119_P	0.953	0.59
18_W	22_E	0.953	0.59
138_K	147_G	0.951	0.59
142_E	146_R	0.946	0.59
46_G	134_K	0.945	0.59
128_G	132_S	0.940	0.58
36_M	119_P	0.933	0.58
11_R	15_K	0.928	0.57
77_K	80_K	0.926	0.57
129_F	142_E	0.918	0.56
34_N	119_P	0.911	0.56
21_N	27_L	0.906	0.55
77_K	98_M	0.898	0.55
27_L	38_Y	0.893	0.54
69_I	81_V	0.878	0.53
148_D	152_E	0.876	0.53
50_K	134_K	0.867	0.52
10_I	55_I	0.867	0.52
67_L	71_N	0.864	0.52
9_R	146_R	0.862	0.52
47_M	56_T	0.859	0.52
127_G	136_P	0.853	0.51
11_R	26_M	0.835	0.50
92_I	112_L	0.830	0.49
60_I	120_I	0.821	0.48
25_N	30_R	0.815	0.48
43_Q	104_E	0.813	0.48
7_I	48_L	0.812	0.48
133_V	136_P	0.810	0.47
40_K	134_K	0.810	0.47
69_I	113_D	0.808	0.47
42_S	132_S	0.807	0.47
26_M	104_E	0.797	0.46
10_I	127_G	0.797	0.46
36_M	86_V	0.793	0.46
45_L	49_N	0.787	0.45
70_I	83_D	0.787	0.45
80_K	126_R	0.785	0.45
125_P	141_G	0.784	0.45
9_R	120_I	0.774	0.44
83_D	151_N	0.773	0.44
20_I	23_T	0.771	0.44
27_L	55_I	0.771	0.44
21_N	25_N	0.770	0.44
30_R	34_N	0.766	0.44
152_E	156_R	0.762	0.43
31_Y	121_R	0.750	0.42
90_L	108_Y	0.746	0.42
8_I	23_T	0.744	0.42
75_T	111_K	0.740	0.42
13_W	148_D	0.735	0.41
10_I	142_E	0.732	0.41
61_D	64_T	0.728	0.41
38_Y	44_I	0.726	0.40
86_V	135_R	0.725	0.40
66_K	88_E	0.723	0.40
81_V	95_I	0.723	0.40
4_L	9_R	0.718	0.40
62_P	65_L	0.706	0.39
38_Y	130_K	0.706	0.39
101_Q	113_D	0.700	0.38
141_G	153_L	0.698	0.38
135_R	143_F	0.698	0.38
6_G	64_T	0.696	0.38
8_I	56_T	0.695	0.38
73_L	117_K	0.695	0.38
69_I	150_I	0.694	0.38
79_D	86_V	0.690	0.37
62_P	71_N	0.683	0.37
12_G	24_L	0.682	0.37
88_E	149_K	0.682	0.37
141_G	146_R	0.680	0.37
20_I	127_G	0.679	0.37
97_A	100_K	0.669	0.36
144_G	157_M	0.667	0.36
5_L	59_E	0.662	0.35
46_G	132_S	0.660	0.35
69_I	116_F	0.656	0.35
18_W	26_M	0.654	0.35
125_P	157_M	0.654	0.35
14_A	48_L	0.645	0.34
27_L	41_T	0.644	0.34
4_L	99_V	0.642	0.34
44_I	113_D	0.642	0.34
33_F	107_I	0.641	0.34
33_F	130_K	0.637	0.33
67_L	100_K	0.635	0.33
98_M	102_L	0.632	0.33
123_H	143_F	0.629	0.33
13_W	34_N	0.627	0.33
109_L	117_K	0.624	0.32
130_K	138_K	0.623	0.32
56_T	59_E	0.623	0.32
142_E	145_Y	0.621	0.32
62_P	116_F	0.619	0.32
74_E	118_L	0.618	0.32
21_N	70_I	0.616	0.32
37_V	65_L	0.614	0.32
85_Y	123_H	0.612	0.32
76_V	80_K	0.610	0.31
71_N	106_K	0.603	0.31
54_Y	155_R	0.600	0.31
124_P	135_R	0.600	0.31
5_L	45_L	0.599	0.31
66_K	71_N	0.599	0.31
38_Y	127_G	0.597	0.30
23_T	36_M	0.595	0.30
124_P	129_F	0.593	0.30
41_T	124_P	0.593	0.30
36_M	77_K	0.589	0.30
8_I	95_I	0.588	0.30
57_W	146_R	0.586	0.30
65_L	68_L	0.583	0.29
102_L	137_Y	0.579	0.29
20_I	126_R	0.578	0.29
28_R	113_D	0.578	0.29
37_V	102_L	0.574	0.29
10_I	40_K	0.573	0.29
90_L	111_K	0.571	0.29
87_K	103_Y	0.562	0.28
8_I	55_I	0.562	0.28
49_N	147_G	0.553	0.27
76_V	114_E	0.549	0.27
62_P	103_Y	0.549	0.27
86_V	108_Y	0.545	0.27
77_K	119_P	0.544	0.27
132_S	136_P	0.543	0.27
92_I	100_K	0.542	0.27
144_G	151_N	0.540	0.27
35_T	64_T	0.532	0.26
69_I	112_L	0.532	0.26
61_D	71_N	0.532	0.26
46_G	157_M	0.531	0.26
102_L	109_L	0.530	0.26
27_L	99_V	0.529	0.26
128_G	141_G	0.528	0.26
62_P	102_L	0.525	0.26
100_K	109_L	0.523	0.25
67_L	120_I	0.522	0.25
18_W	41_T	0.521	0.25
82_S	89_V	0.519	0.25
60_I	97_A	0.518	0.25
132_S	135_R	0.516	0.25
65_L	105_G	0.516	0.25
33_F	157_M	0.513	0.25
98_M	103_Y	0.508	0.24
52_S	57_W	0.507	0.24
37_V	147_G	0.503	0.24
94_N	109_L	0.503	0.24
124_P	134_K	0.502	0.24
96_D	109_L	0.501	0.24
7_I	44_I	0.501	0.24
60_I	84_S	0.500	0.24

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zkrw	1	0.9557	100	0.093	Contact Map
3j65r	2	0.9937	100	0.101	Contact Map
3zf7w	1	0.9873	100	0.122	Contact Map
4a17V	1	0.9873	100	0.122	Contact Map
3j61F	1	0.9873	100	0.124	Contact Map
4ujqI	1	0.9937	100	0.125	Contact Map
1vx75	1	0.9937	100	0.125	Contact Map
3j39F	1	0.9873	100	0.126	Contact Map
4w20F	1	0.9873	100	0.127	Contact Map
3j21Y	1	0.981	100	0.136	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.