RL15 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL15 - 50S ribosomal protein L15

UniProt:	Q9UX85	Sequences: MVVRREKKSRKMRGSRTMGWGIRGQHRDRGSQGGRQIGMHKEKWSWLVKYGKGWYGKHGFRNPTTKLTSAISLRKLNELLESGYIKIKEMDGKKIVDLNELGYNKLLGGGSISIPVTIKVGKATNKAIQKVKEMGGEVILSPTE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (136)
Sequences:	474 (277)
Seq/√Len:	23.7

HALSA - RL15
SULSO - RL15

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
98_L	106_L	5.522	1.00
123_A	138_V	5.110	1.00
9_S	12_M	3.902	1.00
120_V	123_A	3.455	1.00
62_N	66_K	2.977	1.00
62_N	65_T	2.687	0.99
129_Q	133_E	2.639	0.99
20_W	26_H	2.613	0.99
126_K	129_Q	2.604	0.99
12_M	18_M	2.470	0.98
106_L	123_A	2.405	0.98
106_L	120_V	2.393	0.98
16_R	25_Q	1.898	0.92
24_G	28_D	1.753	0.89
128_I	132_K	1.718	0.88
9_S	18_M	1.716	0.88
120_V	138_V	1.697	0.87
89_E	92_G	1.662	0.86
46_W	50_Y	1.661	0.86
80_L	84_Y	1.654	0.86
38_G	110_G	1.637	0.85
99_N	104_N	1.632	0.85
112_I	116_V	1.604	0.84
98_L	123_A	1.544	0.81
37_I	55_Y	1.506	0.80
107_L	124_T	1.470	0.78
82_S	85_I	1.470	0.78
61_R	64_T	1.456	0.77
36_Q	47_L	1.438	0.77
15_S	20_W	1.426	0.76
97_D	100_E	1.375	0.73
118_I	131_V	1.358	0.72
119_K	139_I	1.308	0.69
96_V	116_V	1.307	0.69
88_K	92_G	1.292	0.68
10_R	22_I	1.260	0.66
90_M	94_K	1.241	0.65
77_N	80_L	1.237	0.65
98_L	104_N	1.207	0.63
39_M	55_Y	1.199	0.62
22_I	26_H	1.198	0.62
125_N	129_Q	1.193	0.62
13_R	27_R	1.155	0.59
11_K	21_G	1.146	0.59
97_D	119_K	1.137	0.58
73_L	76_L	1.131	0.58
10_R	14_G	1.120	0.57
25_Q	31_S	1.094	0.55
36_Q	45_S	1.091	0.55
116_V	125_N	1.090	0.55
20_W	25_Q	1.089	0.55
14_G	27_R	1.067	0.53
106_L	138_V	1.059	0.53
82_S	86_K	1.039	0.51
15_S	18_M	1.037	0.51
123_A	128_I	1.020	0.50
10_R	26_H	1.013	0.50
41_K	60_F	1.013	0.50
88_K	91_D	0.990	0.48
34_G	127_A	0.989	0.48
83_G	87_I	0.984	0.47
105_K	124_T	0.984	0.47
23_R	28_D	0.973	0.47
34_G	110_G	0.968	0.46
73_L	130_K	0.967	0.46
77_N	83_G	0.967	0.46
86_K	119_K	0.965	0.46
10_R	27_R	0.961	0.46
22_I	28_D	0.960	0.46
13_R	22_I	0.953	0.45
50_Y	115_P	0.949	0.45
36_Q	137_E	0.941	0.44
17_T	20_W	0.939	0.44
67_L	73_L	0.927	0.44
5_R	18_M	0.925	0.43
14_G	21_G	0.924	0.43
96_V	134_M	0.898	0.42
84_Y	94_K	0.890	0.41
26_H	31_S	0.886	0.41
51_G	54_W	0.882	0.40
72_S	124_T	0.881	0.40
95_I	133_E	0.875	0.40
25_Q	39_M	0.875	0.40
6_E	71_I	0.874	0.40
117_T	129_Q	0.869	0.40
13_R	34_G	0.868	0.39
38_G	127_A	0.835	0.37
113_S	134_M	0.834	0.37
66_K	93_K	0.826	0.37
110_G	130_K	0.821	0.36
22_I	25_Q	0.819	0.36
79_L	115_P	0.812	0.36
7_K	11_K	0.809	0.36
98_L	103_Y	0.808	0.35
114_I	133_E	0.806	0.35
67_L	91_D	0.805	0.35
7_K	12_M	0.800	0.35
81_E	84_Y	0.794	0.35
89_E	111_S	0.791	0.34
38_G	136_G	0.786	0.34
93_K	137_E	0.784	0.34
66_K	134_M	0.784	0.34
13_R	19_G	0.778	0.34
21_G	107_L	0.776	0.33
70_A	124_T	0.775	0.33
45_S	81_E	0.775	0.33
13_R	21_G	0.775	0.33
18_M	46_W	0.774	0.33
68_T	114_I	0.772	0.33
14_G	127_A	0.771	0.33
6_E	18_M	0.767	0.33
104_N	121_G	0.760	0.32
52_K	55_Y	0.755	0.32
42_E	74_R	0.751	0.32
106_L	112_I	0.751	0.32
27_R	135_G	0.746	0.32
54_W	124_T	0.737	0.31
39_M	120_V	0.736	0.31
88_K	132_K	0.735	0.31
5_R	87_I	0.734	0.31
82_S	103_Y	0.732	0.31
44_W	48_V	0.727	0.30
40_H	43_K	0.725	0.30
21_G	24_G	0.717	0.30
72_S	109_G	0.714	0.30
116_V	134_M	0.707	0.29
12_M	17_T	0.701	0.29
41_K	63_P	0.700	0.29
80_L	96_V	0.695	0.29
4_R	62_N	0.689	0.28
104_N	141_S	0.684	0.28
23_R	26_H	0.683	0.28
40_H	55_Y	0.682	0.28
27_R	136_G	0.679	0.28
98_L	138_V	0.678	0.28
98_L	112_I	0.677	0.28
17_T	78_E	0.673	0.27
8_K	12_M	0.667	0.27
13_R	118_I	0.661	0.27
68_T	71_I	0.659	0.27
16_R	20_W	0.655	0.26
78_E	101_L	0.653	0.26
47_L	139_I	0.652	0.26
17_T	112_I	0.650	0.26
85_I	141_S	0.648	0.26
90_M	93_K	0.646	0.26
84_Y	116_V	0.642	0.26
72_S	130_K	0.642	0.26
91_D	126_K	0.638	0.25
101_L	111_S	0.637	0.25
23_R	106_L	0.635	0.25
35_R	59_G	0.634	0.25
69_S	109_G	0.631	0.25
89_E	126_K	0.630	0.25
66_K	97_D	0.627	0.25
11_K	99_N	0.624	0.25
110_G	127_A	0.622	0.25
14_G	34_G	0.621	0.24
113_S	121_G	0.621	0.24
4_R	33_G	0.620	0.24
94_K	98_L	0.612	0.24
81_E	139_I	0.606	0.24
61_R	89_E	0.606	0.24
71_I	106_L	0.606	0.24
69_S	132_K	0.604	0.24
76_L	118_I	0.599	0.23
4_R	7_K	0.598	0.23
111_S	114_I	0.597	0.23
81_E	114_I	0.595	0.23
91_D	133_E	0.594	0.23
77_N	112_I	0.586	0.23
103_Y	119_K	0.586	0.23
122_K	129_Q	0.585	0.23
43_K	114_I	0.585	0.23
56_G	118_I	0.580	0.22
21_G	105_K	0.578	0.22
51_G	61_R	0.576	0.22
19_G	27_R	0.570	0.22
84_Y	140_L	0.567	0.22
11_K	27_R	0.565	0.22
48_V	54_W	0.563	0.22
98_L	120_V	0.562	0.22
14_G	118_I	0.559	0.21
71_I	95_I	0.557	0.21
76_L	96_V	0.556	0.21
68_T	138_V	0.550	0.21
10_R	135_G	0.547	0.21
48_V	58_H	0.544	0.21
12_M	123_A	0.543	0.21
66_K	122_K	0.538	0.20
90_M	138_V	0.537	0.20
14_G	26_H	0.537	0.20
119_K	132_K	0.536	0.20
11_K	33_G	0.536	0.20
32_Q	87_I	0.533	0.20
93_K	115_P	0.529	0.20
4_R	92_G	0.523	0.20
39_M	115_P	0.515	0.19
62_N	67_L	0.508	0.19
63_P	129_Q	0.504	0.19
45_S	121_G	0.503	0.19
57_K	131_V	0.503	0.19
21_G	59_G	0.502	0.19
9_S	46_W	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4w20a	1	0.9583	100	0.321	Contact Map
3zf7b	1	0.9583	100	0.325	Contact Map
3j21L	1	0.9653	100	0.326	Contact Map
4a17K	1	0.9722	100	0.332	Contact Map
3j61a	1	0.9514	100	0.338	Contact Map
1vx7O	1	0.9583	100	0.346	Contact Map
4ujrN	1	0.9583	100	0.369	Contact Map
1vq8L	1	0.8958	100	0.407	Contact Map
3bboN	1	0.9444	99.9	0.563	Contact Map
4tp9L	1	0.0139	99.9	0.631	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.