KCY - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

KCY - Cytidylate kinase

UniProt:	Q9UX81	Sequences: MIIIISGPPGSGKTSVAIKLANELSYKFISAGKIFRDIAQSMGLDIINLNRVAESNFDIDKMVDKKIHEYVLRERNLIVESHIAGWIFREYTDVAIYLWAPLKIRANRIAIRDKISYVEAVSQIIRREYMHYKRFNKFYGIDINDLSVFDLVINTSNIDINNIVKLILDYLSSVSHNSQPLKEKNINDK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	189 (165)
Sequences:	8862 (5523)
Seq/√Len:	430.0

ECOLI - KAD AROL AROK
BACSU - KAD AROK YQAC
HALSA - KCY KAD KAD6 Y2452
SULSO - KCY KAD6 Y1041

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
129_Y	133_K	3.865	1.00
23_E	168_L	3.029	1.00
102_L	132_Y	2.656	1.00
19_K	164_V	2.586	1.00
99_W	152_V	2.479	1.00
50_N	54_E	2.376	1.00
121_V	125_I	2.282	1.00
52_V	60_D	2.278	1.00
104_I	107_N	2.212	1.00
116_S	119_E	2.067	1.00
157_N	166_L	1.998	1.00
64_D	68_H	1.931	1.00
126_R	129_Y	1.909	1.00
159_D	162_N	1.877	1.00
111_I	114_K	1.852	1.00
97_Y	152_V	1.835	1.00
98_L	155_T	1.829	1.00
107_N	111_I	1.806	1.00
110_A	114_K	1.774	1.00
24_L	168_L	1.768	1.00
37_D	41_S	1.766	1.00
104_I	156_S	1.706	1.00
145_D	152_V	1.684	1.00
51_R	55_S	1.677	1.00
126_R	130_M	1.661	1.00
23_E	164_V	1.656	1.00
101_P	156_S	1.654	1.00
111_I	115_I	1.643	1.00
66_K	69_E	1.636	1.00
151_L	170_Y	1.619	1.00
48_N	51_R	1.611	1.00
146_L	152_V	1.610	1.00
40_Q	44_L	1.561	1.00
16_V	167_I	1.557	1.00
39_A	53_A	1.543	1.00
102_L	125_I	1.534	1.00
19_K	22_N	1.526	1.00
109_I	124_I	1.525	1.00
117_Y	120_A	1.516	1.00
130_M	134_R	1.507	1.00
166_L	169_D	1.504	1.00
38_I	65_K	1.485	1.00
65_K	68_H	1.472	1.00
157_N	162_N	1.465	1.00
19_K	161_N	1.442	1.00
94_V	151_L	1.436	1.00
5_I	17_A	1.417	1.00
165_K	169_D	1.401	1.00
24_L	172_S	1.394	1.00
106_A	125_I	1.392	1.00
132_Y	136_N	1.385	1.00
122_S	126_R	1.374	1.00
60_D	63_V	1.364	1.00
42_M	47_I	1.345	1.00
168_L	172_S	1.344	1.00
65_K	69_E	1.342	1.00
16_V	164_V	1.333	1.00
96_I	167_I	1.328	1.00
64_D	67_I	1.283	1.00
47_I	50_N	1.283	1.00
44_L	47_I	1.268	1.00
164_V	168_L	1.248	1.00
97_Y	139_Y	1.202	1.00
117_Y	121_V	1.200	1.00
66_K	72_L	1.181	1.00
11_S	100_A	1.178	1.00
15_S	160_I	1.164	1.00
2_I	89_R	1.160	1.00
26_Y	76_N	1.156	1.00
120_A	123_Q	1.149	1.00
95_A	150_D	1.148	1.00
39_A	50_N	1.140	1.00
94_V	170_Y	1.130	1.00
32_G	36_R	1.124	1.00
86_W	147_S	1.119	1.00
44_L	48_N	1.119	1.00
41_S	45_D	1.103	1.00
18_I	22_N	1.086	1.00
19_K	23_E	1.082	1.00
6_S	139_Y	1.078	1.00
155_T	163_I	1.071	1.00
57_F	126_R	1.058	1.00
122_S	125_I	1.051	1.00
29_I	79_V	1.047	1.00
165_K	168_L	1.036	1.00
166_L	170_Y	1.034	1.00
2_I	93_D	1.033	1.00
162_N	165_K	1.028	1.00
38_I	43_G	1.023	1.00
96_I	170_Y	1.016	1.00
128_E	132_Y	1.015	1.00
43_G	49_L	1.004	1.00
97_Y	132_Y	1.002	1.00
119_E	123_Q	1.002	1.00
98_L	167_I	1.002	1.00
100_A	155_T	0.985	1.00
51_R	54_E	0.981	1.00
39_A	49_L	0.965	1.00
106_A	121_V	0.965	1.00
103_K	107_N	0.960	1.00
20_L	167_I	0.945	1.00
30_S	33_K	0.941	1.00
153_I	163_I	0.938	1.00
66_K	70_Y	0.937	1.00
62_M	66_K	0.934	1.00
125_I	129_Y	0.929	1.00
102_L	129_Y	0.928	1.00
153_I	170_Y	0.925	1.00
70_Y	74_E	0.922	1.00
162_N	166_L	0.914	1.00
20_L	164_V	0.913	1.00
103_K	121_V	0.910	1.00
110_A	121_V	0.899	1.00
38_I	41_S	0.897	1.00
4_I	92_T	0.894	1.00
47_I	51_R	0.885	1.00
52_V	57_F	0.882	1.00
49_L	52_V	0.865	1.00
160_I	164_V	0.859	1.00
110_A	120_A	0.854	1.00
18_I	28_F	0.852	1.00
131_H	135_F	0.844	1.00
123_Q	126_R	0.844	1.00
34_I	38_I	0.843	1.00
49_L	53_A	0.842	1.00
23_E	172_S	0.840	1.00
67_I	70_Y	0.833	1.00
92_T	149_F	0.830	1.00
144_N	147_S	0.824	1.00
94_V	171_L	0.823	1.00
48_N	52_V	0.822	1.00
8_P	131_H	0.820	1.00
154_N	157_N	0.819	1.00
10_G	109_I	0.809	1.00
18_I	21_A	0.804	1.00
87_I	137_K	0.803	1.00
6_S	95_A	0.801	1.00
110_A	113_D	0.784	1.00
157_N	163_I	0.771	1.00
27_K	73_R	0.768	1.00
97_Y	150_D	0.760	1.00
104_I	157_N	0.755	1.00
51_R	60_D	0.753	1.00
2_I	77_L	0.750	1.00
79_V	84_A	0.747	1.00
14_T	80_E	0.741	1.00
8_P	105_R	0.740	1.00
3_I	171_L	0.737	1.00
145_D	148_V	0.716	1.00
16_V	163_I	0.716	1.00
103_K	125_I	0.714	1.00
16_V	160_I	0.714	1.00
21_A	28_F	0.707	1.00
35_F	39_A	0.701	1.00
4_I	84_A	0.698	1.00
39_A	43_G	0.697	1.00
43_G	46_I	0.695	1.00
3_I	94_V	0.694	1.00
56_N	60_D	0.693	1.00
72_L	89_R	0.690	1.00
17_A	28_F	0.689	1.00
99_W	139_Y	0.689	1.00
29_I	77_L	0.689	1.00
12_G	15_S	0.684	1.00
144_N	148_V	0.683	1.00
26_Y	77_L	0.682	1.00
154_N	166_L	0.675	1.00
12_G	108_R	0.673	1.00
106_A	110_A	0.672	1.00
61_K	87_I	0.670	1.00
161_N	165_K	0.668	1.00
101_P	104_I	0.665	1.00
61_K	85_G	0.664	1.00
53_A	56_N	0.660	1.00
86_W	145_D	0.654	0.99
84_A	88_F	0.648	0.99
42_M	50_N	0.642	0.99
57_F	61_K	0.641	0.99
7_G	10_G	0.636	0.99
58_D	61_K	0.631	0.99
147_S	150_D	0.630	0.99
61_K	88_F	0.628	0.99
76_N	93_D	0.627	0.99
77_L	92_T	0.626	0.99
102_L	128_E	0.624	0.99
48_N	62_M	0.611	0.99
119_E	122_S	0.611	0.99
103_K	106_A	0.609	0.99
5_I	20_L	0.609	0.99
27_K	66_K	0.606	0.99
54_E	60_D	0.605	0.99
8_P	11_S	0.605	0.99
57_F	136_N	0.603	0.99
102_L	121_V	0.602	0.99
35_F	53_A	0.600	0.99
9_P	123_Q	0.599	0.99
57_F	60_D	0.598	0.99
27_K	75_R	0.593	0.99
5_I	78_I	0.587	0.99
83_I	88_F	0.585	0.99
155_T	167_I	0.583	0.99
70_Y	73_R	0.582	0.99
20_L	168_L	0.579	0.99
64_D	70_Y	0.576	0.99
110_A	117_Y	0.573	0.99
36_R	127_R	0.569	0.99
52_V	55_S	0.569	0.99
52_V	56_N	0.565	0.98
10_G	124_I	0.564	0.98
126_R	133_K	0.564	0.98
139_Y	150_D	0.563	0.98
86_W	138_F	0.552	0.98
28_F	33_K	0.552	0.98
135_F	138_F	0.551	0.98
5_I	98_L	0.551	0.98
64_D	137_K	0.550	0.98
129_Y	132_Y	0.550	0.98
100_A	105_R	0.550	0.98
138_F	150_D	0.548	0.98
153_I	166_L	0.548	0.98
20_L	78_I	0.545	0.98
27_K	72_L	0.540	0.98
85_G	88_F	0.540	0.98
93_D	171_L	0.537	0.98
118_V	121_V	0.536	0.98
52_V	63_V	0.534	0.98
39_A	42_M	0.534	0.98
82_H	100_A	0.533	0.98
31_A	34_I	0.530	0.98
99_W	154_N	0.529	0.98
32_G	84_A	0.528	0.98
35_F	38_I	0.527	0.98
5_I	96_I	0.523	0.97
79_V	89_R	0.523	0.97
27_K	77_L	0.520	0.97
7_G	11_S	0.518	0.97
2_I	92_T	0.517	0.97
23_E	165_K	0.517	0.97
50_N	60_D	0.516	0.97
116_S	120_A	0.512	0.97
51_R	57_F	0.512	0.97
134_R	138_F	0.511	0.97
27_K	76_N	0.511	0.97
105_R	128_E	0.510	0.97
39_A	46_I	0.509	0.97
106_A	124_I	0.505	0.97
37_D	69_E	0.501	0.97
62_M	65_K	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qbgB	1	0.9153	100	0.388	Contact Map
2xb4A	4	0.8942	99.9	0.403	Contact Map
3be4A	1	0.8783	99.9	0.41	Contact Map
3tlxA	1	0.8995	99.9	0.411	Contact Map
4jzkA	1	0.8942	99.9	0.413	Contact Map
1akyA	1	0.9048	99.9	0.414	Contact Map
3gmtA	1	0.8042	99.9	0.419	Contact Map
1zd8A	1	0.9153	99.9	0.422	Contact Map
4pzlA	2	0.9048	99.9	0.422	Contact Map
1ak2A	1	0.9153	99.9	0.422	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.