ARCH - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARCH - Protein archease

UniProt:	Q9UX79	Sequences: MRQFEFFEHTADVGIKSYGRSLEEAFSNAALGVFEVITDTSKVRPVEYREIYLNGYDLENLLYKWIEELLYYYDSELMIFSKFDLMIDQDSITLEGKAWGERFNDKIHERRTVVKAMTYHQLSIEKTESGYVITFVVDI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	139 (136)
Sequences:	539 (424)
Seq/√Len:	36.3

SULSO - ARCH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_E	16_K	4.052	1.00
67_E	117_M	3.024	1.00
52_Y	95_E	3.018	1.00
101_E	108_H	2.927	1.00
16_K	134_T	2.782	1.00
7_F	14_G	2.651	1.00
25_A	133_I	2.372	1.00
55_G	64_K	2.370	1.00
18_Y	28_N	2.316	0.99
20_R	24_E	2.246	0.99
63_Y	122_L	2.230	0.99
14_G	136_V	2.154	0.99
16_K	132_V	2.010	0.98
69_L	98_A	2.003	0.98
54_N	93_T	1.989	0.98
104_N	107_I	1.955	0.98
44_R	107_I	1.943	0.98
30_A	65_W	1.891	0.98
127_T	130_G	1.859	0.97
84_D	97_K	1.854	0.97
104_N	108_H	1.851	0.97
66_I	117_M	1.799	0.97
67_E	122_L	1.773	0.97
80_F	83_F	1.763	0.97
68_E	72_Y	1.685	0.95
49_R	76_E	1.643	0.95
43_V	101_E	1.609	0.94
35_E	40_T	1.570	0.93
30_A	98_A	1.565	0.93
19_G	24_E	1.561	0.93
6_F	35_E	1.553	0.93
71_Y	75_S	1.538	0.93
33_V	114_V	1.454	0.90
19_G	28_N	1.452	0.90
52_Y	86_M	1.428	0.90
82_K	99_W	1.381	0.88
117_M	135_F	1.372	0.88
68_E	71_Y	1.366	0.87
74_D	113_V	1.351	0.87
30_A	69_L	1.343	0.86
86_M	95_E	1.315	0.85
127_T	132_V	1.287	0.84
26_F	62_L	1.279	0.84
116_A	120_H	1.258	0.83
30_A	83_F	1.245	0.82
65_W	96_G	1.238	0.82
38_T	110_R	1.228	0.81
126_K	131_Y	1.227	0.81
19_G	25_A	1.221	0.81
101_E	107_I	1.216	0.80
52_Y	93_T	1.209	0.80
63_Y	67_E	1.189	0.79
34_F	73_Y	1.161	0.77
48_Y	97_K	1.147	0.76
38_T	103_F	1.143	0.76
48_Y	99_W	1.143	0.76
123_S	134_T	1.119	0.74
9_H	73_Y	1.110	0.74
110_R	114_V	1.095	0.73
50_E	95_E	1.092	0.73
34_F	69_L	1.080	0.72
17_S	25_A	1.066	0.71
57_D	124_I	1.051	0.70
4_F	35_E	1.048	0.69
23_E	85_L	1.026	0.68
10_T	116_A	1.022	0.67
120_H	136_V	1.010	0.67
24_E	52_Y	1.009	0.66
7_F	137_V	1.008	0.66
69_L	96_G	1.005	0.66
119_Y	122_L	0.997	0.66
3_Q	18_Y	0.993	0.65
33_V	70_L	0.985	0.65
113_V	117_M	0.973	0.64
55_G	60_N	0.972	0.64
116_A	135_F	0.963	0.63
65_W	117_M	0.958	0.62
33_V	66_I	0.950	0.62
61_L	68_E	0.935	0.60
63_Y	123_S	0.921	0.59
15_I	137_V	0.908	0.58
66_I	113_V	0.907	0.58
124_I	135_F	0.903	0.58
45_P	81_S	0.901	0.58
48_Y	127_T	0.883	0.56
17_S	114_V	0.883	0.56
61_L	94_L	0.878	0.56
29_A	62_L	0.870	0.55
32_G	94_L	0.868	0.55
3_Q	28_N	0.855	0.54
51_I	96_G	0.854	0.54
47_E	102_R	0.841	0.52
27_S	84_D	0.818	0.50
32_G	47_E	0.815	0.50
72_Y	78_M	0.812	0.50
9_H	121_Q	0.802	0.49
22_L	26_F	0.802	0.49
5_E	11_A	0.800	0.49
65_W	134_T	0.798	0.49
50_E	97_K	0.788	0.48
32_G	116_A	0.787	0.48
45_P	82_K	0.784	0.47
25_A	137_V	0.777	0.47
51_I	78_M	0.776	0.47
9_H	12_D	0.773	0.46
122_L	135_F	0.773	0.46
33_V	37_I	0.771	0.46
87_I	94_L	0.768	0.46
123_S	132_V	0.765	0.46
43_V	100_G	0.759	0.45
15_I	32_G	0.755	0.45
27_S	85_L	0.753	0.45
72_Y	76_E	0.746	0.44
43_V	108_H	0.744	0.44
60_N	119_Y	0.743	0.44
14_G	134_T	0.739	0.44
44_R	93_T	0.739	0.44
114_V	137_V	0.737	0.43
56_Y	60_N	0.735	0.43
117_M	137_V	0.725	0.42
121_Q	134_T	0.720	0.42
117_M	122_L	0.718	0.42
6_F	137_V	0.705	0.41
15_I	135_F	0.704	0.41
37_I	109_E	0.702	0.40
53_L	94_L	0.700	0.40
13_V	43_V	0.690	0.39
17_S	133_I	0.688	0.39
28_N	31_L	0.687	0.39
18_Y	121_Q	0.686	0.39
57_D	60_N	0.686	0.39
8_E	95_E	0.685	0.39
20_R	27_S	0.681	0.39
56_Y	63_Y	0.675	0.38
21_S	24_E	0.669	0.38
23_E	87_I	0.661	0.37
3_Q	24_E	0.654	0.36
54_N	91_S	0.651	0.36
67_E	75_S	0.650	0.36
6_F	16_K	0.649	0.36
36_V	63_Y	0.646	0.36
3_Q	20_R	0.644	0.36
70_L	73_Y	0.639	0.35
79_I	102_R	0.638	0.35
80_F	98_A	0.634	0.35
25_A	135_F	0.629	0.34
41_S	136_V	0.623	0.34
88_D	92_I	0.617	0.33
73_Y	103_F	0.616	0.33
84_D	104_N	0.613	0.33
115_K	118_T	0.612	0.33
131_Y	136_V	0.605	0.33
44_R	88_D	0.599	0.32
120_H	135_F	0.598	0.32
101_E	114_V	0.598	0.32
66_I	83_F	0.596	0.32
49_R	120_H	0.595	0.32
53_L	122_L	0.594	0.32
34_F	83_F	0.586	0.31
6_F	37_I	0.582	0.31
53_L	68_E	0.578	0.31
112_T	119_Y	0.577	0.30
4_F	110_R	0.564	0.29
41_S	65_W	0.562	0.29
65_W	69_L	0.562	0.29
67_E	70_L	0.559	0.29
6_F	111_R	0.557	0.29
26_F	30_A	0.555	0.29
68_E	135_F	0.554	0.29
25_A	124_I	0.553	0.29
85_L	93_T	0.552	0.29
9_H	113_V	0.551	0.29
38_T	112_T	0.544	0.28
78_M	83_F	0.540	0.28
38_T	111_R	0.539	0.28
34_F	79_I	0.538	0.28
84_D	123_S	0.536	0.27
49_R	72_Y	0.535	0.27
33_V	135_F	0.534	0.27
85_L	90_D	0.530	0.27
15_I	71_Y	0.530	0.27
61_L	108_H	0.528	0.27
24_E	95_E	0.524	0.27
13_V	64_K	0.523	0.27
43_V	78_M	0.522	0.27
87_I	119_Y	0.520	0.26
10_T	70_L	0.518	0.26
20_R	29_A	0.518	0.26
111_R	120_H	0.516	0.26
72_Y	99_W	0.516	0.26
18_Y	134_T	0.516	0.26
44_R	123_S	0.515	0.26
59_E	124_I	0.514	0.26
47_E	128_E	0.514	0.26
86_M	139_I	0.513	0.26
54_N	104_N	0.513	0.26
15_I	38_T	0.512	0.26
32_G	59_E	0.507	0.26
94_L	107_I	0.503	0.25
5_E	34_F	0.502	0.25
22_L	106_K	0.502	0.25
71_Y	94_L	0.502	0.25
30_A	96_G	0.501	0.25
53_L	61_L	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jw3A	1	0.9928	100	0.073	Contact Map
4n2pA	2	1	100	0.078	Contact Map
1j5uA	1	0.8633	100	0.277	Contact Map
1wv8A	2	0.4245	71.5	0.913	Contact Map
3gkuA	2	0.8777	50.6	0.924	Contact Map
2yztA	2	0.3957	29.9	0.933	Contact Map
2dsyA	3	0.4101	18.1	0.94	Contact Map
3kwrA	2	0.518	15.3	0.942	Contact Map
2lmcA	1	0.3597	11	0.945	Contact Map
1r7lA	2	0.2806	9.6	0.947	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.