PURQ - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PURQ - Phosphoribosylformylglycinamidine synthase subunit PurQ

UniProt:	Q9UX21	Sequences: MIAIIKFPGTTCETDVYKALIEAGVPTVIVKYKDFDPDRYNGVILPGGFSFGDYLRAGSIAASTETMKKVKQMAEDGKIVIGICNGFQILVESGLLKGALLPNLKLRFISKWVYLKVIRADTILTKGLDKKIIRMPIAHAEGRYYVDDIDYAKTHMVLQYCDENGNISEDVNPNGSLLNIASIANEEGNVIGMMPHPERASFKLTSIDGTVDGLILLRRLGEWA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	224 (208)
Sequences:	3208 (1561)
Seq/√Len:	108.2

ECOLI - PUR4
BACSU - PURQ
HALSA - PURQ
SULSO - PURQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_V	83_I	3.594	1.00
131_K	215_I	3.262	1.00
104_L	143_R	3.132	1.00
185_N	189_N	3.106	1.00
146_V	150_D	2.982	1.00
147_D	150_D	2.882	1.00
118_I	159_Q	2.757	1.00
42_G	79_I	2.675	1.00
16_V	44_I	2.495	1.00
91_V	100_L	2.398	1.00
71_K	75_E	2.369	1.00
80_V	190_V	2.361	1.00
116_K	132_I	2.319	1.00
20_L	44_I	2.295	1.00
21_I	26_P	2.239	1.00
5_I	45_L	2.181	1.00
72_Q	76_D	2.166	1.00
157_V	184_A	2.125	1.00
19_A	201_S	2.107	1.00
214_L	218_R	2.046	1.00
28_V	40_Y	2.038	1.00
12_C	199_R	2.024	1.00
73_M	78_K	2.020	1.00
35_F	66_T	2.015	1.00
114_Y	132_I	1.955	1.00
79_I	123_I	1.877	1.00
115_L	133_I	1.858	1.00
3_A	30_V	1.848	1.00
69_K	72_Q	1.818	1.00
32_Y	64_T	1.794	1.00
144_Y	183_I	1.770	1.00
59_S	92_E	1.767	1.00
6_K	29_I	1.708	1.00
122_T	157_V	1.679	1.00
112_W	134_R	1.675	1.00
158_L	182_S	1.667	1.00
17_Y	29_I	1.654	1.00
117_V	158_L	1.649	1.00
128_L	133_I	1.640	1.00
127_G	219_R	1.635	1.00
20_L	42_G	1.622	1.00
109_I	137_I	1.616	1.00
137_I	173_P	1.541	1.00
116_K	161_C	1.527	1.00
10_T	46_P	1.511	1.00
101_L	145_Y	1.480	1.00
156_M	180_I	1.475	1.00
12_C	138_A	1.460	1.00
17_Y	21_I	1.447	1.00
146_V	151_Y	1.431	1.00
138_A	199_R	1.431	1.00
160_Y	181_A	1.427	1.00
155_H	184_A	1.426	1.00
215_I	218_R	1.416	1.00
114_Y	161_C	1.409	1.00
87_F	192_G	1.397	1.00
153_K	186_E	1.390	1.00
44_I	81_I	1.372	1.00
25_V	221_G	1.369	1.00
182_S	193_M	1.365	1.00
38_D	72_Q	1.355	1.00
173_P	179_N	1.354	1.00
20_L	25_V	1.352	1.00
172_N	179_N	1.340	1.00
122_T	184_A	1.332	0.99
108_F	138_A	1.330	0.99
132_I	161_C	1.322	0.99
136_P	200_A	1.320	0.99
184_A	188_G	1.307	0.99
155_H	186_E	1.273	0.99
162_D	171_V	1.264	0.99
105_K	109_I	1.264	0.99
116_K	159_Q	1.256	0.99
119_R	129_D	1.253	0.99
21_I	27_T	1.243	0.99
157_V	191_I	1.242	0.99
119_R	154_T	1.236	0.99
114_Y	134_R	1.234	0.99
5_I	70_V	1.229	0.99
74_A	95_L	1.215	0.99
185_N	190_V	1.213	0.99
18_K	22_E	1.192	0.99
37_P	43_V	1.169	0.99
57_A	141_E	1.161	0.99
49_F	84_C	1.155	0.99
156_M	159_Q	1.143	0.98
91_V	96_L	1.140	0.98
72_Q	75_E	1.127	0.98
148_D	178_L	1.125	0.98
101_L	143_R	1.104	0.98
125_T	158_L	1.103	0.98
59_S	63_S	1.103	0.98
171_V	179_N	1.100	0.98
203_K	211_V	1.100	0.98
102_P	106_L	1.097	0.98
12_C	135_M	1.096	0.98
159_Q	178_L	1.096	0.98
119_R	188_G	1.091	0.98
87_F	96_L	1.088	0.98
92_E	99_A	1.072	0.98
148_D	177_L	1.057	0.97
41_N	77_G	1.056	0.97
113_V	137_I	1.054	0.97
13_E	29_I	1.044	0.97
43_V	80_V	1.041	0.97
128_L	215_I	1.035	0.97
38_D	69_K	1.034	0.97
127_G	218_R	1.030	0.97
119_R	122_T	1.021	0.97
151_Y	177_L	1.020	0.97
184_A	191_I	1.010	0.97
4_I	20_L	1.006	0.97
158_L	191_I	1.001	0.96
113_V	173_P	0.990	0.96
22_E	201_S	0.983	0.96
43_V	78_K	0.968	0.96
145_Y	177_L	0.962	0.95
23_A	214_L	0.960	0.95
18_K	201_S	0.950	0.95
43_V	73_M	0.948	0.95
10_T	13_E	0.938	0.95
67_M	93_S	0.933	0.95
115_L	197_P	0.931	0.95
11_T	84_C	0.931	0.95
156_M	178_L	0.930	0.95
57_A	100_L	0.930	0.95
28_V	36_D	0.925	0.94
58_G	62_A	0.920	0.94
149_I	152_A	0.918	0.94
96_L	190_V	0.915	0.94
33_K	64_T	0.907	0.94
138_A	198_E	0.902	0.94
22_E	202_F	0.895	0.93
96_L	192_G	0.894	0.93
146_V	183_I	0.890	0.93
127_G	215_I	0.890	0.93
111_K	137_I	0.885	0.93
125_T	157_V	0.864	0.92
57_A	102_P	0.860	0.92
90_L	190_V	0.857	0.92
151_Y	178_L	0.856	0.92
67_M	70_V	0.854	0.92
102_P	140_A	0.853	0.92
6_K	17_Y	0.832	0.91
117_V	128_L	0.831	0.91
87_F	100_L	0.826	0.90
58_G	89_I	0.825	0.90
36_D	69_K	0.823	0.90
180_I	183_I	0.822	0.90
4_I	46_P	0.816	0.90
28_V	39_R	0.813	0.90
80_V	90_L	0.810	0.89
84_C	174_N	0.809	0.89
204_L	209_G	0.804	0.89
122_T	125_T	0.800	0.89
39_R	69_K	0.792	0.88
151_Y	156_M	0.790	0.88
128_L	131_K	0.783	0.88
161_C	179_N	0.779	0.88
154_T	188_G	0.779	0.88
183_I	192_G	0.769	0.87
17_Y	27_T	0.762	0.86
100_L	144_Y	0.760	0.86
73_M	79_I	0.757	0.86
182_S	192_G	0.757	0.86
7_F	61_A	0.752	0.86
4_I	17_Y	0.746	0.85
49_F	174_N	0.744	0.85
68_K	71_K	0.743	0.85
102_P	107_R	0.742	0.85
70_V	74_A	0.735	0.84
11_T	138_A	0.735	0.84
75_E	187_E	0.733	0.84
59_S	99_A	0.731	0.84
108_F	198_E	0.729	0.84
121_D	154_T	0.724	0.83
122_T	188_G	0.720	0.83
139_H	174_N	0.719	0.83
30_V	36_D	0.715	0.83
155_H	185_N	0.713	0.83
35_F	69_K	0.712	0.82
44_I	83_I	0.712	0.82
46_P	110_S	0.711	0.82
42_G	124_L	0.708	0.82
146_V	178_L	0.705	0.82
100_L	192_G	0.700	0.81
157_V	188_G	0.692	0.81
162_D	173_P	0.692	0.81
74_A	80_V	0.689	0.80
128_L	216_L	0.687	0.80
7_F	32_Y	0.682	0.80
67_M	71_K	0.681	0.80
77_G	189_N	0.678	0.79
203_K	209_G	0.676	0.79
120_A	184_A	0.674	0.79
84_C	141_E	0.671	0.79
85_N	88_Q	0.669	0.78
49_F	139_H	0.669	0.78
56_R	92_E	0.667	0.78
66_T	69_K	0.667	0.78
36_D	39_R	0.665	0.78
49_F	196_H	0.663	0.78
120_A	123_I	0.662	0.78
146_V	177_L	0.661	0.78
53_D	84_C	0.656	0.77
37_P	66_T	0.654	0.77
172_N	176_S	0.653	0.77
7_F	10_T	0.651	0.76
11_T	139_H	0.650	0.76
37_P	69_K	0.644	0.76
6_K	34_D	0.643	0.76
68_K	72_Q	0.641	0.75
117_V	133_I	0.633	0.74
51_F	64_T	0.632	0.74
115_L	181_A	0.632	0.74
120_A	129_D	0.630	0.74
110_S	138_A	0.625	0.73
84_C	139_H	0.622	0.73
14_T	29_I	0.622	0.73
28_V	34_D	0.622	0.73
42_G	220_L	0.620	0.73
11_T	199_R	0.619	0.73
79_I	189_N	0.618	0.73
19_A	24_G	0.617	0.73
113_V	162_D	0.614	0.72
135_M	199_R	0.613	0.72
20_L	27_T	0.612	0.72
73_M	76_D	0.609	0.72
90_L	192_G	0.608	0.71
152_A	156_M	0.606	0.71
194_M	198_E	0.606	0.71
120_A	130_K	0.604	0.71
84_C	88_Q	0.604	0.71
127_G	130_K	0.602	0.71
42_G	81_I	0.601	0.71
50_S	174_N	0.599	0.70
3_A	40_Y	0.599	0.70
18_K	23_A	0.598	0.70
128_L	219_R	0.598	0.70
158_L	193_M	0.596	0.70
126_K	219_R	0.595	0.70
36_D	66_T	0.592	0.69
58_G	190_V	0.591	0.69
11_T	49_F	0.589	0.69
123_I	126_K	0.588	0.69
92_E	95_L	0.587	0.69
81_I	191_I	0.586	0.69
84_C	196_H	0.583	0.68
119_R	184_A	0.576	0.67
133_I	136_P	0.575	0.67
7_F	64_T	0.575	0.67
20_L	23_A	0.574	0.67
62_A	71_K	0.574	0.67
124_L	191_I	0.572	0.67
57_A	140_A	0.570	0.67
49_F	53_D	0.567	0.66
116_K	130_K	0.567	0.66
36_D	40_Y	0.563	0.66
162_D	179_N	0.563	0.66
13_E	110_S	0.562	0.65
4_I	27_T	0.558	0.65
113_V	134_R	0.557	0.65
139_H	196_H	0.552	0.64
23_A	221_G	0.550	0.64
7_F	67_M	0.550	0.64
114_Y	179_N	0.548	0.64
133_I	214_L	0.548	0.64
61_A	89_I	0.547	0.63
13_E	158_L	0.546	0.63
95_L	190_V	0.546	0.63
47_G	88_Q	0.544	0.63
112_W	135_M	0.543	0.63
114_Y	171_V	0.542	0.63
40_Y	73_M	0.540	0.62
127_G	131_K	0.536	0.62
79_I	220_L	0.536	0.62
49_F	194_M	0.535	0.62
55_L	59_S	0.534	0.62
139_H	194_M	0.534	0.62
156_M	183_I	0.533	0.61
174_N	196_H	0.533	0.61
45_L	70_V	0.532	0.61
12_C	16_V	0.530	0.61
125_T	191_I	0.528	0.61
81_I	157_V	0.528	0.61
47_G	196_H	0.528	0.61
22_E	218_R	0.526	0.60
108_F	214_L	0.525	0.60
66_T	70_V	0.524	0.60
25_V	42_G	0.524	0.60
84_C	194_M	0.523	0.60
18_K	33_K	0.523	0.60
25_V	79_I	0.522	0.60
174_N	194_M	0.521	0.60
197_P	213_G	0.521	0.60
117_V	131_K	0.520	0.60
22_E	216_L	0.519	0.59
5_I	14_T	0.517	0.59
23_A	107_R	0.515	0.59
85_N	194_M	0.515	0.59
45_L	90_L	0.513	0.59
56_R	61_A	0.512	0.58
72_Q	148_D	0.512	0.58
30_V	40_Y	0.511	0.58
188_G	191_I	0.510	0.58
32_Y	51_F	0.509	0.58
139_H	198_E	0.508	0.58
45_L	89_I	0.508	0.58
152_A	178_L	0.506	0.57
35_F	38_D	0.506	0.57
144_Y	177_L	0.500	0.57
200_A	210_T	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lgyA	1	1	100	0.421	Contact Map
3d54D	1	0.9241	100	0.639	Contact Map
1l9xA	1	0.9375	99.9	0.746	Contact Map
3fijA	4	0.8393	99.9	0.76	Contact Map
2w7tA	1	0.8661	99.8	0.77	Contact Map
1wl8A	1	0.8036	99.8	0.77	Contact Map
2vxoA	2	0.7902	99.8	0.772	Contact Map
2ywbA	4	0.7902	99.8	0.772	Contact Map
4l8fC	3	0.9107	99.8	0.775	Contact Map
2vpiA	1	0.7634	99.8	0.777	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.