SPEH - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SPEH - S-adenosylmethionine decarboxylase proenzyme

UniProt:	Q9UWY8	Sequences: MMMGVELAFPKVVGKQVYGSLYECDEDVLKDTKRLEQIIKEAADIGNMNILDIKSWKIGEGVSVVAIILESHITIHTWPEYRFATVDVYSCGPHTSPLNAFRYIVEKLGAKRYTINEADRSSEF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (109)
Sequences:	892 (580)
Seq/√Len:	55.6

BACSU - SPEH
SULSO - SPEH ARGDC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_L	108_L	3.209	1.00
25_D	109_G	3.205	1.00
43_A	50_I	2.857	1.00
55_S	64_V	2.784	1.00
23_E	111_K	2.632	1.00
63_S	68_I	2.598	1.00
53_I	66_A	2.425	1.00
98_L	117_E	2.312	1.00
38_I	104_I	2.305	1.00
36_E	40_K	2.260	1.00
19_G	101_F	2.170	1.00
32_T	36_E	2.046	1.00
85_T	89_Y	2.019	1.00
50_I	66_A	1.982	1.00
78_W	85_T	1.938	1.00
41_E	45_I	1.920	1.00
31_D	34_R	1.886	1.00
28_V	34_R	1.881	1.00
37_Q	41_E	1.850	0.99
18_Y	118_A	1.830	0.99
23_E	112_R	1.743	0.99
75_I	86_V	1.734	0.99
41_E	44_D	1.691	0.99
23_E	110_A	1.606	0.98
35_L	62_V	1.591	0.98
34_R	38_I	1.522	0.98
70_E	91_C	1.472	0.97
21_L	104_I	1.443	0.97
98_L	102_R	1.403	0.96
55_S	66_A	1.322	0.95
35_L	75_I	1.319	0.95
19_G	88_V	1.311	0.95
36_E	53_I	1.292	0.94
75_I	84_A	1.266	0.94
40_K	53_I	1.260	0.93
38_I	107_K	1.192	0.91
39_I	73_I	1.192	0.91
47_N	96_S	1.188	0.91
32_T	62_V	1.173	0.91
102_R	105_V	1.170	0.90
22_Y	112_R	1.161	0.90
32_T	57_K	1.156	0.90
27_D	106_E	1.134	0.89
105_V	113_Y	1.099	0.87
12_V	89_Y	1.079	0.87
58_I	80_E	1.070	0.86
55_S	65_V	1.065	0.86
46_G	90_S	1.059	0.85
58_I	91_C	1.048	0.85
32_T	55_S	1.038	0.84
13_V	81_Y	1.026	0.84
57_K	60_E	0.996	0.82
63_S	74_T	0.993	0.82
64_V	78_W	0.993	0.82
48_M	85_T	0.988	0.81
65_V	74_T	0.984	0.81
16_Q	87_D	0.966	0.80
43_A	66_A	0.955	0.79
48_M	92_G	0.941	0.78
51_L	69_L	0.934	0.77
43_A	84_A	0.921	0.76
17_V	115_I	0.913	0.76
80_E	91_C	0.908	0.75
41_E	77_T	0.897	0.74
28_V	109_G	0.892	0.74
14_G	71_S	0.886	0.74
41_E	103_Y	0.885	0.73
36_E	55_S	0.885	0.73
40_K	50_I	0.871	0.72
24_C	110_A	0.863	0.72
61_G	71_S	0.844	0.70
32_T	63_S	0.836	0.69
21_L	114_T	0.827	0.68
17_V	101_F	0.827	0.68
20_S	121_S	0.819	0.68
113_Y	119_D	0.817	0.67
68_I	90_S	0.811	0.67
22_Y	101_F	0.810	0.67
30_K	60_E	0.809	0.67
88_V	105_V	0.803	0.66
114_T	118_A	0.802	0.66
42_A	103_Y	0.799	0.66
20_S	60_E	0.799	0.66
19_G	104_I	0.791	0.65
56_W	62_V	0.787	0.64
49_N	70_E	0.787	0.64
42_A	46_G	0.783	0.64
42_A	92_G	0.783	0.64
116_N	119_D	0.780	0.64
38_I	75_I	0.769	0.63
41_E	107_K	0.756	0.61
28_V	38_I	0.752	0.61
33_K	106_E	0.740	0.60
40_K	66_A	0.740	0.60
73_I	104_I	0.731	0.59
60_E	82_R	0.718	0.57
65_V	78_W	0.703	0.56
49_N	96_S	0.701	0.56
86_V	89_Y	0.697	0.55
45_I	99_N	0.696	0.55
24_C	67_I	0.693	0.55
21_L	113_Y	0.689	0.54
56_W	69_L	0.680	0.53
17_V	21_L	0.677	0.53
37_Q	99_N	0.674	0.53
34_R	113_Y	0.670	0.52
43_A	73_I	0.657	0.51
51_L	58_I	0.655	0.51
20_S	54_K	0.655	0.51
21_L	105_V	0.654	0.51
30_K	59_G	0.652	0.50
92_G	100_A	0.640	0.49
51_L	78_W	0.639	0.49
34_R	109_G	0.635	0.48
30_K	57_K	0.635	0.48
71_S	77_T	0.628	0.48
31_D	41_E	0.626	0.47
20_S	57_K	0.624	0.47
35_L	64_V	0.621	0.47
27_D	107_K	0.618	0.47
42_A	48_M	0.601	0.45
20_S	116_N	0.600	0.45
78_W	81_Y	0.599	0.45
102_R	106_E	0.596	0.44
41_E	99_N	0.595	0.44
31_D	96_S	0.590	0.44
52_D	66_A	0.589	0.44
16_Q	74_T	0.579	0.42
73_I	85_T	0.577	0.42
44_D	55_S	0.575	0.42
13_V	51_L	0.573	0.42
12_V	15_K	0.568	0.41
37_Q	112_R	0.568	0.41
31_D	44_D	0.565	0.41
67_I	117_E	0.562	0.41
39_I	101_F	0.558	0.40
35_L	86_V	0.552	0.40
84_A	110_A	0.551	0.40
89_Y	105_V	0.550	0.39
76_H	79_P	0.547	0.39
34_R	107_K	0.543	0.39
27_D	45_I	0.541	0.39
43_A	100_A	0.541	0.39
27_D	30_K	0.541	0.39
25_D	38_I	0.536	0.38
53_I	96_S	0.535	0.38
19_G	115_I	0.534	0.38
114_T	119_D	0.532	0.38
73_I	90_S	0.532	0.38
93_P	109_G	0.527	0.37
17_V	103_Y	0.525	0.37
113_Y	116_N	0.524	0.37
44_D	102_R	0.523	0.37
39_I	85_T	0.523	0.37
63_S	67_I	0.520	0.36
29_L	121_S	0.520	0.36
64_V	121_S	0.518	0.36
33_K	45_I	0.514	0.36
58_I	70_E	0.514	0.36
13_V	78_W	0.510	0.35
87_D	120_R	0.504	0.35
90_S	95_T	0.504	0.35
96_S	102_R	0.503	0.35
45_I	103_Y	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2iiiA	2	0.9194	100	0.178	Contact Map
1vr7A	2	0.9274	100	0.183	Contact Map
3c6kA	2	0.8226	58.4	0.915	Contact Map
1mhmA	1	0.8871	55.7	0.917	Contact Map
1jl0A	2	0.879	19.9	0.935	Contact Map
4u3eA	2	0.7661	14.6	0.939	Contact Map
4adnA	2	0.3387	10.1	0.943	Contact Map
2od0A	2	0.3871	9.2	0.944	Contact Map
2yb5A	1	0.3387	8.6	0.945	Contact Map
1nq6A	1	0.7097	6.4	0.948	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.