ARGDC - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ARGDC - Arginine decarboxylase proenzyme

UniProt:	Q9UWU1	Sequences: MSEREVLQKINSPEGKEDRIIGKHVFGNLYDIDAERLNDKEFLEKLVLEAVDIAHMKLVEIKAWSFGGKKGGVSVIALVEESHIALHTWNEYNYATLDVYTCGEDSDPQSAFAHIVNALNPKRYQMFYADRSSQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	134 (112)
Sequences:	884 (577)
Seq/√Len:	54.5

BACSU - SPEH
SULSO - ARGDC SPEH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_D	120_N	3.104	1.00
43_L	119_L	2.954	1.00
51_V	58_L	2.856	1.00
63_A	75_V	2.741	1.00
31_D	122_K	2.634	1.00
61_I	77_A	2.403	1.00
74_S	79_V	2.348	1.00
109_Q	128_Y	2.290	1.00
44_E	48_L	2.156	1.00
96_T	100_Y	2.142	1.00
46_L	115_I	2.111	1.00
27_G	112_F	2.107	1.00
40_K	44_E	1.963	1.00
45_K	49_E	1.912	1.00
49_E	53_I	1.898	1.00
89_W	96_T	1.872	0.99
58_L	77_A	1.822	0.99
36_R	42_F	1.806	0.99
38_N	70_K	1.790	0.99
31_D	123_R	1.786	0.99
43_L	73_V	1.733	0.99
86_L	97_L	1.732	0.99
39_D	42_F	1.706	0.99
67_G	70_K	1.658	0.99
26_F	129_A	1.656	0.99
31_D	121_P	1.626	0.98
49_E	52_D	1.557	0.98
81_E	102_C	1.542	0.98
29_L	115_I	1.420	0.96
42_F	46_L	1.410	0.96
55_H	107_D	1.359	0.95
63_A	77_A	1.312	0.94
86_L	95_A	1.296	0.94
48_L	61_I	1.293	0.94
46_L	118_A	1.283	0.94
109_Q	113_A	1.245	0.93
66_F	91_E	1.242	0.92
43_L	86_L	1.209	0.91
27_G	99_V	1.155	0.89
30_Y	123_R	1.150	0.89
91_E	102_C	1.130	0.88
44_E	61_I	1.122	0.88
35_E	117_N	1.120	0.88
65_S	71_G	1.119	0.88
40_K	65_S	1.086	0.86
74_S	85_A	1.078	0.86
66_F	102_C	1.063	0.85
76_I	85_A	1.047	0.84
40_K	73_V	1.035	0.84
116_V	124_Y	1.032	0.83
54_A	101_T	1.028	0.83
63_A	76_I	1.013	0.82
21_I	92_Y	1.005	0.82
113_A	116_V	1.005	0.82
51_V	77_A	1.004	0.82
36_R	120_N	0.992	0.81
59_V	80_E	0.991	0.81
22_G	82_S	0.990	0.81
32_I	121_P	0.988	0.81
47_V	84_I	0.988	0.81
44_E	63_A	0.945	0.78
20_I	100_Y	0.936	0.77
70_K	101_T	0.936	0.77
24_H	98_D	0.935	0.77
49_E	114_H	0.922	0.76
56_M	103_G	0.922	0.76
25_V	126_M	0.915	0.75
48_L	58_L	0.903	0.74
57_K	81_E	0.901	0.74
41_E	117_N	0.896	0.74
56_M	96_T	0.892	0.73
25_V	112_F	0.890	0.73
79_V	101_T	0.871	0.72
97_L	100_Y	0.863	0.71
50_A	103_G	0.859	0.70
75_V	89_W	0.844	0.69
49_E	88_T	0.839	0.69
50_A	114_H	0.825	0.67
49_E	118_A	0.819	0.67
57_K	107_D	0.816	0.66
124_Y	130_D	0.811	0.66
70_K	93_N	0.809	0.66
42_F	124_Y	0.806	0.66
66_F	70_K	0.801	0.65
42_F	120_N	0.795	0.64
45_K	123_R	0.788	0.64
40_K	63_A	0.778	0.63
125_Q	129_A	0.774	0.62
25_V	29_L	0.772	0.62
53_I	117_N	0.771	0.62
35_E	118_A	0.767	0.62
27_G	126_M	0.767	0.62
29_L	125_Q	0.765	0.61
30_Y	112_F	0.753	0.60
19_R	129_A	0.753	0.60
50_A	54_A	0.750	0.60
29_L	116_V	0.750	0.60
84_I	115_I	0.743	0.59
107_D	113_A	0.740	0.59
36_R	46_L	0.740	0.59
64_W	73_V	0.734	0.58
76_I	89_W	0.731	0.58
127_F	130_D	0.719	0.57
53_I	110_S	0.718	0.57
45_K	110_S	0.712	0.56
72_G	82_S	0.706	0.55
50_A	56_M	0.706	0.55
28_N	132_S	0.705	0.55
32_I	78_L	0.704	0.55
41_E	53_I	0.691	0.54
51_V	95_A	0.690	0.54
60_E	77_A	0.675	0.52
99_V	116_V	0.666	0.51
98_D	131_R	0.660	0.50
89_W	92_Y	0.659	0.50
95_A	121_P	0.658	0.50
50_A	111_A	0.647	0.49
49_E	110_S	0.646	0.49
97_L	121_P	0.642	0.49
43_L	97_L	0.629	0.47
46_L	86_L	0.625	0.47
43_L	75_V	0.622	0.46
40_K	74_S	0.619	0.46
51_V	84_I	0.616	0.46
74_S	89_W	0.612	0.45
75_V	132_S	0.610	0.45
113_A	117_N	0.608	0.45
42_F	118_A	0.606	0.45
35_E	38_N	0.605	0.45
28_N	65_S	0.605	0.45
27_G	115_I	0.599	0.44
29_L	124_Y	0.593	0.43
64_W	80_E	0.591	0.43
28_N	71_G	0.590	0.43
58_L	63_A	0.590	0.43
46_L	119_L	0.582	0.42
70_K	90_N	0.581	0.42
38_N	65_S	0.579	0.42
104_E	120_N	0.578	0.42
100_Y	116_V	0.574	0.41
56_M	106_S	0.572	0.41
36_R	39_D	0.571	0.41
45_K	128_Y	0.571	0.41
61_I	75_V	0.568	0.41
56_M	100_Y	0.567	0.41
21_I	89_W	0.564	0.40
48_L	77_A	0.559	0.40
103_G	108_P	0.556	0.39
51_V	111_A	0.553	0.39
48_L	52_D	0.546	0.38
47_V	112_F	0.545	0.38
52_D	113_A	0.543	0.38
124_Y	127_F	0.542	0.38
59_V	89_W	0.541	0.38
125_Q	130_D	0.541	0.38
89_W	94_Y	0.536	0.37
110_S	120_N	0.535	0.37
39_D	49_E	0.522	0.36
52_D	63_A	0.522	0.36
84_I	96_T	0.521	0.36
21_I	59_V	0.520	0.36
84_I	101_T	0.520	0.36
28_N	127_F	0.508	0.35
75_V	86_L	0.508	0.35
107_D	110_S	0.507	0.35
42_F	45_K	0.502	0.34
23_K	107_D	0.501	0.34
38_N	78_L	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2iiiA	2	0.8507	100	0.17	Contact Map
1vr7A	2	0.8582	100	0.184	Contact Map
1mhmA	1	0.8955	91.2	0.884	Contact Map
1jl0A	2	0.806	81.1	0.9	Contact Map
3c6kA	2	0.7612	41.8	0.923	Contact Map
2qmxA	3	0.4627	12.7	0.94	Contact Map
3ifvA	3	0.6642	10.3	0.943	Contact Map
1plqA	3	0.6866	9.6	0.944	Contact Map
4hnzA	5	0.9328	9	0.944	Contact Map
4lubA	2	0.4552	9	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.