Q981C6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q981C6 - Molybdenum cofactor biosynthesis protein B (MoaB)

UniProt:	Q981C6	Sequences: MNNLMSAHKQHRQHAPTNINFYVITISTSRYEKLVRKEPLIDESGDIIKQLIIQSNYNIIGYELVPDEKVKILKAFANALDNSQTDVIISTGGTGYTQSDVTVETIRRIFDREIEGFSDVFRLVSYNDPEVKSASYLTKATAGIINDKVIFLLPGSPDAVRLAMKELILPEIGHLLYIVRRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	182 (145)
Sequences:	7921 (5249)
Seq/√Len:	435.9

ECOLI - MOEA MOG MOAB
BACSU - MOEA MOAB
HALSA - Q9HST2 Q9HST3 Q9HP37
SULSO - Q981C6 Q97W71 Q7LXN4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_Y	85_T	3.666	1.00
73_L	108_R	3.459	1.00
52_I	57_Y	3.229	1.00
124_V	127_N	2.478	1.00
51_L	165_K	2.203	1.00
69_K	108_R	2.195	1.00
107_R	113_E	2.145	1.00
119_D	122_R	2.039	1.00
69_K	73_L	2.021	1.00
60_I	85_T	2.005	1.00
47_I	161_R	1.880	1.00
66_P	71_K	1.861	1.00
21_F	52_I	1.815	1.00
73_L	77_A	1.814	1.00
49_K	53_I	1.794	1.00
20_N	58_N	1.782	1.00
151_F	168_I	1.766	1.00
68_E	71_K	1.751	1.00
28_T	99_S	1.738	1.00
63_E	75_A	1.732	1.00
69_K	105_T	1.726	1.00
23_V	49_K	1.724	1.00
106_I	152_L	1.701	1.00
31_Y	39_P	1.688	1.00
75_A	78_N	1.664	1.00
24_I	79_A	1.656	1.00
55_S	164_M	1.632	1.00
22_Y	79_A	1.626	1.00
77_A	109_I	1.622	1.00
69_K	104_E	1.622	1.00
55_S	169_L	1.543	1.00
73_L	109_I	1.523	1.00
169_L	173_G	1.521	1.00
96_Y	114_I	1.509	1.00
164_M	168_I	1.496	1.00
20_N	60_I	1.435	1.00
122_R	167_L	1.394	1.00
48_I	164_M	1.382	1.00
65_V	75_A	1.379	1.00
18_N	58_N	1.372	1.00
106_I	150_I	1.370	1.00
44_S	91_T	1.349	1.00
80_L	148_K	1.345	1.00
49_K	62_Y	1.339	1.00
87_V	172_I	1.316	1.00
25_T	91_T	1.277	1.00
32_E	39_P	1.268	1.00
88_I	148_K	1.249	1.00
43_E	157_P	1.236	1.00
151_F	171_E	1.216	1.00
75_A	79_A	1.197	1.00
111_D	146_N	1.191	1.00
113_E	136_Y	1.189	1.00
120_V	167_L	1.175	1.00
24_I	75_A	1.156	1.00
71_K	75_A	1.130	1.00
120_V	123_L	1.129	1.00
30_R	40_L	1.128	1.00
26_I	72_I	1.128	1.00
70_V	74_K	1.127	1.00
26_I	65_V	1.121	1.00
52_I	59_I	1.112	1.00
74_K	78_N	1.109	1.00
51_L	164_M	1.089	1.00
158_D	162_L	1.083	1.00
70_V	73_L	1.080	1.00
22_Y	62_Y	1.071	1.00
52_I	164_M	1.070	1.00
133_S	152_L	1.062	1.00
78_N	84_Q	1.053	1.00
29_S	40_L	1.052	1.00
47_I	157_P	1.050	1.00
90_S	150_I	1.045	1.00
71_K	74_K	1.043	1.00
28_T	66_P	1.042	1.00
24_I	65_V	1.034	1.00
93_G	102_T	1.027	1.00
47_I	51_L	1.024	1.00
63_E	78_N	1.024	1.00
50_Q	54_Q	1.021	1.00
104_E	107_R	1.019	1.00
153_L	163_A	1.012	1.00
51_L	55_S	0.985	1.00
89_I	153_L	0.984	1.00
73_L	105_T	0.982	1.00
165_K	169_L	0.978	1.00
69_K	101_V	0.975	1.00
42_D	45_G	0.975	1.00
46_D	50_Q	0.971	1.00
32_E	46_D	0.967	1.00
25_T	45_G	0.957	1.00
123_L	127_N	0.927	1.00
81_D	84_Q	0.923	1.00
117_F	134_A	0.920	1.00
23_V	59_I	0.917	1.00
103_V	118_S	0.915	1.00
81_D	146_N	0.906	1.00
47_I	160_V	0.905	1.00
47_I	50_Q	0.904	1.00
62_Y	85_T	0.899	1.00
45_G	61_G	0.894	1.00
121_F	163_A	0.883	1.00
87_V	151_F	0.882	1.00
62_Y	79_A	0.878	1.00
115_E	136_Y	0.871	1.00
122_R	163_A	0.866	1.00
132_K	167_L	0.859	1.00
103_V	107_R	0.855	1.00
89_I	168_I	0.852	1.00
173_G	178_I	0.850	1.00
24_I	63_E	0.849	1.00
25_T	64_L	0.847	1.00
69_K	72_I	0.846	1.00
42_D	46_D	0.844	1.00
48_I	91_T	0.822	1.00
68_E	72_I	0.821	1.00
26_I	102_T	0.816	1.00
21_F	57_Y	0.810	1.00
19_I	57_Y	0.810	1.00
79_A	85_T	0.805	1.00
31_Y	41_I	0.804	1.00
77_A	146_N	0.795	1.00
161_R	165_K	0.794	1.00
32_E	42_D	0.794	1.00
134_A	149_V	0.788	1.00
49_K	59_I	0.786	1.00
72_I	105_T	0.783	1.00
20_N	86_D	0.771	1.00
17_T	86_D	0.769	1.00
23_V	52_I	0.766	1.00
25_T	42_D	0.759	1.00
16_P	176_L	0.749	1.00
76_F	106_I	0.746	1.00
46_D	62_Y	0.744	1.00
56_N	59_I	0.744	1.00
164_M	169_L	0.739	1.00
112_R	135_S	0.736	1.00
118_S	133_S	0.728	1.00
126_Y	159_A	0.711	1.00
62_Y	84_Q	0.705	1.00
134_A	151_F	0.704	1.00
125_S	163_A	0.701	1.00
118_S	122_R	0.695	1.00
20_N	85_T	0.694	1.00
163_A	167_L	0.694	1.00
51_L	161_R	0.692	1.00
149_V	175_L	0.679	1.00
72_I	101_V	0.677	1.00
90_S	102_T	0.674	1.00
49_K	61_G	0.670	1.00
42_D	64_L	0.670	1.00
21_F	87_V	0.669	1.00
115_E	118_S	0.667	1.00
25_T	63_E	0.667	1.00
132_K	163_A	0.662	1.00
173_G	176_L	0.660	1.00
105_T	109_I	0.660	1.00
80_L	88_I	0.657	1.00
120_V	126_Y	0.643	0.99
23_V	45_G	0.640	0.99
90_S	152_L	0.638	0.99
153_L	160_V	0.633	0.99
78_N	81_D	0.632	0.99
154_P	159_A	0.632	0.99
52_I	89_I	0.631	0.99
22_Y	61_G	0.631	0.99
29_S	39_P	0.630	0.99
137_L	146_N	0.618	0.99
76_F	90_S	0.617	0.99
175_L	178_I	0.612	0.99
60_I	84_Q	0.610	0.99
94_T	152_L	0.608	0.99
48_I	153_L	0.607	0.99
79_A	88_I	0.605	0.99
48_I	160_V	0.604	0.99
87_V	149_V	0.602	0.99
23_V	48_I	0.600	0.99
65_V	71_K	0.598	0.99
94_T	102_T	0.598	0.99
57_Y	172_I	0.598	0.99
124_V	167_L	0.596	0.99
77_A	81_D	0.596	0.99
120_V	132_K	0.587	0.99
123_L	126_Y	0.587	0.99
171_E	175_L	0.586	0.99
80_L	146_N	0.582	0.99
120_V	124_V	0.581	0.99
53_I	58_N	0.577	0.99
101_V	104_E	0.574	0.99
96_Y	119_D	0.572	0.99
76_F	88_I	0.568	0.99
114_I	118_S	0.564	0.99
90_S	106_I	0.563	0.98
87_V	175_L	0.556	0.98
67_D	155_G	0.556	0.98
103_V	133_S	0.556	0.98
154_P	163_A	0.552	0.98
94_T	103_V	0.549	0.98
50_Q	53_I	0.549	0.98
26_I	90_S	0.548	0.98
72_I	76_F	0.546	0.98
90_S	94_T	0.537	0.98
68_E	101_V	0.532	0.98
106_I	112_R	0.529	0.98
104_E	108_R	0.527	0.98
25_T	44_S	0.526	0.98
102_T	150_I	0.524	0.98
81_D	85_T	0.519	0.97
55_S	173_G	0.514	0.97
45_G	62_Y	0.514	0.97
32_E	62_Y	0.513	0.97
105_T	108_R	0.512	0.97
112_R	137_L	0.507	0.97
85_T	88_I	0.505	0.97
95_G	127_N	0.504	0.97
136_Y	149_V	0.503	0.97
113_E	118_S	0.501	0.97
149_V	171_E	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4pd0A	2	0.9396	100	0.219	Contact Map
1g8lA	2	0.9066	100	0.23	Contact Map
1uz5A	1	0.8791	100	0.233	Contact Map
1wu2A	2	0.8242	100	0.272	Contact Map
1jljA	3	0.8297	100	0.305	Contact Map
4lhbA	4	0.8297	100	0.307	Contact Map
3rfqA	5	0.8407	100	0.31	Contact Map
3iwtA	4	0.8736	100	0.319	Contact Map
1y5eA	4	0.8516	100	0.328	Contact Map
1di6A	3	0.8077	100	0.343	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.