Q981B6 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q981B6 - Uncharacterized protein

UniProt:	Q981B6	Sequences: MKIGVVQPLEVKSAILLAEKALKEGAELVLLPEKWTRNIDDVPLLEFQKLAKRYTAYILPGAFEDGVSVITPIIDDSGNLKGIAKKIHLFNEERVRLIPGNEAVLFTYRGIRFGISICYDIDFPEVVRELFSKGAEIILVPSKIRSNGLDIWNEFLRIRVLENRIGIVNANVYNPPDFPGRSVAIVPEQRQDGIVIPKVVGELGSEESYMIVDIDPLKYMYLRGDRLKEYVKFTVKEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	238 (218)
Sequences:	13688 (9415)
Seq/√Len:	637.7

ECOLI - YBEM YAFV YOBB
BACSU - MTNU YHCX
HALSA - Q9HQZ3
SULSO - Q981B6 Q97ZZ7 Q97WN8

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
107_T	112_R	3.159	1.00
6_V	9_L	2.816	1.00
14_A	35_W	2.572	1.00
184_A	212_V	2.553	1.00
159_R	162_E	2.509	1.00
186_V	190_R	2.400	1.00
203_L	208_S	2.392	1.00
13_S	207_E	2.383	1.00
114_G	130_L	2.321	1.00
71_T	85_K	2.297	1.00
64_E	85_K	2.296	1.00
116_S	127_V	2.283	1.00
15_I	46_E	2.120	1.00
57_Y	76_D	2.069	1.00
30_L	139_L	2.066	1.00
26_A	211_I	2.026	1.00
136_E	220_M	2.023	1.00
15_I	50_L	2.014	1.00
24_E	211_I	2.006	1.00
29_V	56_A	2.000	1.00
19_E	54_Y	1.963	1.00
19_E	53_R	1.957	1.00
67_V	98_I	1.926	1.00
27_E	109_R	1.890	1.00
15_I	19_E	1.885	1.00
13_S	16_L	1.852	1.00
69_V	85_K	1.849	1.00
20_K	24_E	1.819	1.00
154_E	157_R	1.817	1.00
108_Y	111_I	1.811	1.00
166_G	187_P	1.778	1.00
76_D	109_R	1.749	1.00
75_D	79_N	1.728	1.00
112_R	136_E	1.713	1.00
138_I	165_I	1.710	1.00
71_T	83_I	1.633	1.00
49_K	53_R	1.628	1.00
113_F	137_I	1.613	1.00
47_F	60_P	1.607	1.00
18_A	29_V	1.596	1.00
92_E	95_V	1.586	1.00
30_L	170_A	1.583	1.00
14_A	31_L	1.569	1.00
75_D	81_K	1.546	1.00
16_L	20_K	1.545	1.00
57_Y	108_Y	1.541	1.00
156_L	169_N	1.536	1.00
59_L	139_L	1.536	1.00
62_A	73_I	1.535	1.00
50_L	54_Y	1.530	1.00
168_V	184_A	1.510	1.00
116_S	140_V	1.492	1.00
18_A	58_I	1.491	1.00
48_Q	74_I	1.485	1.00
51_A	58_I	1.479	1.00
218_K	221_Y	1.472	1.00
17_L	20_K	1.470	1.00
91_N	94_R	1.462	1.00
28_L	139_L	1.459	1.00
57_Y	81_K	1.447	1.00
185_I	194_I	1.433	1.00
153_N	157_R	1.414	1.00
127_V	138_I	1.411	1.00
59_L	115_I	1.385	1.00
62_A	83_I	1.378	1.00
12_K	16_L	1.378	1.00
116_S	126_V	1.373	1.00
21_A	209_Y	1.372	1.00
125_E	128_R	1.330	1.00
19_E	50_L	1.326	1.00
9_L	12_K	1.326	1.00
113_F	139_L	1.306	1.00
8_P	12_K	1.296	1.00
221_Y	225_D	1.289	1.00
44_L	72_P	1.286	1.00
36_T	43_P	1.280	1.00
18_A	50_L	1.270	1.00
15_I	53_R	1.249	1.00
129_E	133_K	1.240	1.00
26_A	29_V	1.233	1.00
18_A	56_A	1.221	1.00
127_V	140_V	1.219	1.00
82_G	104_V	1.216	1.00
154_E	161_L	1.212	1.00
172_V	176_P	1.209	1.00
11_V	46_E	1.202	1.00
119_Y	123_F	1.197	1.00
69_V	98_I	1.192	1.00
45_L	48_Q	1.192	1.00
137_I	168_V	1.191	1.00
45_L	49_K	1.184	1.00
27_E	76_D	1.184	1.00
46_E	49_K	1.182	1.00
166_G	195_V	1.173	1.00
9_L	13_S	1.169	1.00
41_D	44_L	1.167	1.00
186_V	218_K	1.165	1.00
135_A	138_I	1.154	1.00
12_K	46_E	1.150	1.00
84_A	104_V	1.145	1.00
11_V	15_I	1.143	1.00
13_S	17_L	1.138	1.00
153_N	202_E	1.135	1.00
153_N	201_G	1.134	1.00
17_L	209_Y	1.129	1.00
203_L	206_E	1.105	1.00
160_V	167_I	1.078	1.00
55_T	76_D	1.068	1.00
15_I	49_K	1.063	1.00
73_I	115_I	1.062	1.00
22_L	56_A	1.062	1.00
156_L	185_I	1.050	1.00
51_A	75_D	1.049	1.00
156_L	167_I	1.047	1.00
153_N	183_V	1.036	1.00
49_K	52_K	1.026	1.00
59_L	73_I	1.010	1.00
8_P	42_V	1.010	1.00
46_E	50_L	1.007	1.00
156_L	183_V	0.994	1.00
131_F	165_I	0.993	1.00
111_I	136_E	0.987	1.00
220_M	224_G	0.987	1.00
57_Y	73_I	0.984	1.00
186_V	195_V	0.975	1.00
181_R	204_G	0.972	1.00
154_E	158_I	0.971	1.00
114_G	135_A	0.970	1.00
82_G	106_F	0.968	1.00
149_L	181_R	0.961	1.00
160_V	185_I	0.960	1.00
150_D	157_R	0.958	1.00
111_I	137_I	0.948	1.00
84_A	120_D	0.945	1.00
62_A	72_P	0.933	1.00
217_L	220_M	0.931	1.00
128_R	163_N	0.923	1.00
64_E	71_T	0.914	1.00
217_L	221_Y	0.911	1.00
20_K	23_K	0.910	1.00
47_F	58_I	0.906	1.00
105_L	135_A	0.905	1.00
44_L	48_Q	0.905	1.00
34_K	97_L	0.905	1.00
19_E	23_K	0.905	1.00
50_L	53_R	0.904	1.00
173_Y	206_E	0.900	1.00
57_Y	109_R	0.882	1.00
22_L	54_Y	0.881	1.00
202_E	210_M	0.875	1.00
166_G	219_Y	0.873	1.00
34_K	39_I	0.873	1.00
215_D	218_K	0.871	1.00
44_L	80_L	0.871	1.00
73_I	106_F	0.870	1.00
64_E	69_V	0.870	1.00
150_D	153_N	0.869	1.00
136_E	216_P	0.868	1.00
152_W	169_N	0.866	1.00
166_G	214_I	0.865	1.00
87_I	126_V	0.864	1.00
105_L	112_R	0.857	1.00
128_R	132_S	0.851	1.00
14_A	60_P	0.849	1.00
44_L	74_I	0.846	1.00
108_Y	113_F	0.844	1.00
41_D	45_L	0.842	1.00
74_I	80_L	0.841	1.00
8_P	46_E	0.827	1.00
21_A	26_A	0.823	1.00
48_Q	51_A	0.819	1.00
14_A	47_F	0.819	1.00
143_K	172_V	0.810	1.00
202_E	208_S	0.803	1.00
88_H	120_D	0.801	1.00
16_L	19_E	0.795	1.00
30_L	59_L	0.790	1.00
107_T	110_G	0.789	1.00
7_Q	11_V	0.788	1.00
145_R	148_G	0.788	1.00
31_L	35_W	0.779	1.00
18_A	31_L	0.778	1.00
24_E	209_Y	0.774	1.00
166_G	218_K	0.773	1.00
121_I	156_L	0.772	1.00
218_K	222_L	0.770	1.00
173_Y	207_E	0.764	1.00
140_V	167_I	0.753	1.00
28_L	59_L	0.752	1.00
201_G	210_M	0.750	1.00
86_K	118_C	0.749	1.00
28_L	110_G	0.745	1.00
188_E	222_L	0.744	1.00
130_L	135_A	0.743	1.00
18_A	54_Y	0.742	1.00
43_P	46_E	0.739	1.00
116_S	130_L	0.731	1.00
12_K	15_I	0.727	1.00
138_I	167_I	0.726	1.00
111_I	216_P	0.725	1.00
216_P	220_M	0.719	1.00
48_Q	79_N	0.718	1.00
121_I	140_V	0.716	1.00
143_K	178_F	0.715	1.00
28_L	57_Y	0.710	1.00
181_R	202_E	0.708	1.00
14_A	18_A	0.704	1.00
88_H	123_F	0.702	1.00
131_F	163_N	0.701	1.00
64_E	83_I	0.697	1.00
195_V	212_V	0.689	1.00
23_K	54_Y	0.687	1.00
87_I	103_A	0.685	1.00
11_V	47_F	0.684	1.00
183_V	194_I	0.684	1.00
7_Q	43_P	0.682	1.00
51_A	54_Y	0.680	1.00
90_F	119_Y	0.678	1.00
34_K	63_F	0.673	1.00
200_V	210_M	0.671	1.00
172_V	178_F	0.668	1.00
103_A	126_V	0.667	1.00
219_Y	223_R	0.663	1.00
57_Y	110_G	0.663	1.00
102_E	105_L	0.660	1.00
44_L	50_L	0.659	1.00
35_W	60_P	0.658	1.00
80_L	83_I	0.658	1.00
27_E	110_G	0.657	1.00
190_R	218_K	0.655	1.00
21_A	29_V	0.655	1.00
30_L	168_V	0.654	1.00
144_I	148_G	0.652	1.00
57_Y	75_D	0.651	1.00
70_I	86_K	0.650	1.00
204_G	208_S	0.649	1.00
106_F	113_F	0.649	1.00
171_N	182_S	0.647	1.00
129_E	132_S	0.636	1.00
65_D	68_S	0.636	1.00
26_A	56_A	0.633	1.00
21_A	56_A	0.632	1.00
159_R	163_N	0.627	1.00
62_A	71_T	0.626	1.00
42_V	45_L	0.625	1.00
150_D	154_E	0.606	1.00
195_V	200_V	0.606	1.00
122_D	155_F	0.604	1.00
203_L	210_M	0.602	1.00
103_A	130_L	0.601	1.00
19_E	22_L	0.601	1.00
170_A	184_A	0.600	1.00
112_R	133_K	0.600	1.00
63_F	97_L	0.599	1.00
39_I	97_L	0.596	1.00
21_A	25_G	0.595	1.00
73_I	83_I	0.593	1.00
119_Y	122_D	0.592	1.00
48_Q	52_K	0.592	1.00
186_V	189_Q	0.591	1.00
57_Y	74_I	0.589	1.00
36_T	47_F	0.588	1.00
126_V	130_L	0.584	1.00
29_V	209_Y	0.583	1.00
155_F	158_I	0.581	1.00
189_Q	195_V	0.581	1.00
22_L	55_T	0.578	1.00
90_F	122_D	0.576	1.00
90_F	144_I	0.575	1.00
20_K	209_Y	0.575	1.00
48_Q	80_L	0.568	1.00
36_T	60_P	0.566	1.00
171_N	179_P	0.564	1.00
122_D	144_I	0.557	1.00
20_K	208_S	0.555	1.00
70_I	117_I	0.553	1.00
42_V	46_E	0.549	1.00
105_L	133_K	0.549	1.00
72_P	75_D	0.548	1.00
61_G	70_I	0.547	1.00
22_L	26_A	0.545	1.00
59_L	74_I	0.545	1.00
75_D	80_L	0.545	1.00
70_I	118_C	0.545	1.00
149_L	179_P	0.544	1.00
114_G	138_I	0.544	1.00
6_V	10_E	0.543	1.00
57_Y	113_F	0.542	1.00
11_V	43_P	0.541	1.00
55_T	77_S	0.540	1.00
121_I	155_F	0.536	0.99
87_I	129_E	0.533	0.99
148_G	151_I	0.532	0.99
60_P	74_I	0.530	0.99
11_V	50_L	0.530	0.99
39_I	118_C	0.529	0.99
27_E	55_T	0.529	0.99
144_I	179_P	0.529	0.99
131_F	229_E	0.524	0.99
33_E	118_C	0.523	0.99
164_R	222_L	0.523	0.99
15_I	54_Y	0.521	0.99
44_L	60_P	0.521	0.99
11_V	36_T	0.521	0.99
153_N	185_I	0.520	0.99
93_E	97_L	0.518	0.99
219_Y	222_L	0.517	0.99
144_I	169_N	0.516	0.99
139_L	168_V	0.515	0.99
151_I	188_E	0.514	0.99
213_D	216_P	0.514	0.99
128_R	229_E	0.514	0.99
34_K	70_I	0.513	0.99
130_L	138_I	0.513	0.99
34_K	37_R	0.513	0.99
82_G	115_I	0.512	0.99
153_N	181_R	0.509	0.99
157_R	185_I	0.509	0.99
137_I	166_G	0.506	0.99
31_L	60_P	0.503	0.99
117_I	120_D	0.503	0.99
144_I	152_W	0.502	0.99
17_L	31_L	0.502	0.99
160_V	189_Q	0.501	0.99
8_P	11_V	0.501	0.99
131_F	135_A	0.500	0.99
158_I	161_L	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2vhhA	5	0.9706	100	0.19	Contact Map
4izuA	2	0.9244	100	0.198	Contact Map
3ivzA	2	0.9538	100	0.199	Contact Map
3p8kA	2	0.9622	100	0.201	Contact Map
2w1vA	2	0.9664	100	0.205	Contact Map
1emsA	3	0.9664	100	0.215	Contact Map
1uf5A	4	0.9706	100	0.217	Contact Map
2e11A	2	0.9538	100	0.22	Contact Map
4hg5A	2	0.9664	100	0.221	Contact Map
3wuyA	2	0.9244	100	0.226	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0084 seconds.