Q981A9 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q981A9 - Uncharacterized protein

UniProt:	Q981A9	Sequences: MISKFSFQRLKKGALKYLVLESLNERPMRTYEIIKTIEKKFEGSYRPSTGSVYPVLKSLVEKNLVEVKVENNKKIYIITEKGKNELQEIKNKSLKLLGDNTKFSRQILQELLQIAFYLYDNRSKIDENNIQKIIEYLRNCRNQLKNVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	148 (138)
Sequences:	1005 (662)
Seq/√Len:	56.4

ECOLI - YQJI
SULSO - Q981A9 Q981A0 Q7LX63

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
139_N	143_Q	6.711	1.00
80_E	83_K	4.282	1.00
133_I	144_L	4.074	1.00
19_V	33_I	3.568	1.00
66_E	77_I	3.274	1.00
136_Y	140_C	3.211	1.00
57_K	61_E	2.949	1.00
109_Q	138_R	2.434	1.00
25_E	40_K	2.426	1.00
26_R	32_E	2.360	1.00
36_T	39_K	2.104	1.00
93_S	97_L	1.982	1.00
126_D	129_N	1.964	1.00
90_K	94_L	1.960	1.00
94_L	98_G	1.945	1.00
24_N	90_K	1.819	0.99
67_V	76_Y	1.791	0.99
84_N	88_E	1.779	0.99
69_V	72_N	1.753	0.99
135_E	142_N	1.646	0.99
85_E	89_I	1.643	0.99
89_I	92_K	1.568	0.98
81_K	84_N	1.555	0.98
129_N	132_K	1.548	0.98
19_V	52_V	1.544	0.98
118_L	144_L	1.534	0.98
87_Q	90_K	1.533	0.98
28_M	36_T	1.529	0.98
13_G	16_K	1.453	0.97
62_K	78_I	1.390	0.96
39_K	59_L	1.384	0.96
137_L	140_C	1.378	0.96
67_V	74_K	1.377	0.96
140_C	144_L	1.365	0.96
136_Y	143_Q	1.348	0.96
113_Q	138_R	1.345	0.95
109_Q	113_Q	1.342	0.95
56_L	76_Y	1.335	0.95
110_E	138_R	1.330	0.95
23_L	78_I	1.319	0.95
24_N	83_K	1.314	0.95
41_F	45_Y	1.296	0.94
132_K	135_E	1.291	0.94
73_K	94_L	1.264	0.94
84_N	87_Q	1.250	0.93
85_E	88_E	1.249	0.93
68_K	77_I	1.191	0.92
10_L	45_Y	1.167	0.91
64_L	85_E	1.131	0.89
131_Q	138_R	1.128	0.89
40_K	101_T	1.118	0.89
125_I	129_N	1.118	0.89
114_I	144_L	1.085	0.87
55_V	59_L	1.073	0.87
22_S	27_P	1.050	0.85
12_K	15_L	1.035	0.85
114_I	140_C	1.023	0.84
106_Q	136_Y	1.020	0.84
83_K	87_Q	1.019	0.84
125_I	133_I	1.009	0.83
10_L	99_D	1.001	0.83
111_L	115_A	1.000	0.82
21_E	97_L	0.996	0.82
55_V	58_S	0.988	0.82
21_E	25_E	0.978	0.81
23_L	28_M	0.972	0.81
139_N	142_N	0.962	0.80
19_V	55_V	0.947	0.79
51_S	55_V	0.947	0.79
15_L	145_K	0.931	0.78
24_N	68_K	0.918	0.77
41_F	100_N	0.917	0.77
16_K	55_V	0.896	0.75
41_F	75_I	0.896	0.75
16_K	107_I	0.895	0.75
73_K	119_Y	0.886	0.74
25_E	128_N	0.879	0.74
28_M	33_I	0.879	0.74
121_N	125_I	0.877	0.73
67_V	73_K	0.876	0.73
35_K	46_R	0.874	0.73
60_V	67_V	0.873	0.73
66_E	80_E	0.866	0.72
24_N	37_I	0.866	0.72
36_T	40_K	0.860	0.72
49_T	76_Y	0.859	0.72
24_N	80_E	0.858	0.72
11_K	19_V	0.855	0.71
9_R	12_K	0.847	0.71
19_V	89_I	0.847	0.71
132_K	143_Q	0.838	0.70
138_R	142_N	0.835	0.70
16_K	62_K	0.833	0.69
86_L	89_I	0.824	0.69
63_N	81_K	0.806	0.67
60_V	69_V	0.803	0.67
38_E	43_G	0.800	0.66
17_Y	78_I	0.800	0.66
28_M	32_E	0.798	0.66
134_I	138_R	0.795	0.66
39_K	73_K	0.794	0.66
46_R	52_V	0.787	0.65
13_G	51_S	0.782	0.65
37_I	40_K	0.777	0.64
10_L	19_V	0.771	0.63
93_S	96_L	0.770	0.63
98_G	114_I	0.768	0.63
120_D	145_K	0.754	0.62
133_I	141_R	0.754	0.62
108_L	116_F	0.747	0.61
80_E	87_Q	0.740	0.60
141_R	145_K	0.737	0.60
25_E	107_I	0.727	0.59
50_G	54_P	0.719	0.58
44_S	76_Y	0.716	0.58
13_G	79_T	0.714	0.58
58_S	72_N	0.712	0.57
29_R	32_E	0.710	0.57
127_E	130_I	0.706	0.57
10_L	15_L	0.705	0.57
110_E	134_I	0.703	0.56
64_L	79_T	0.700	0.56
21_E	24_N	0.696	0.56
37_I	44_S	0.696	0.56
60_V	118_L	0.685	0.54
37_I	104_S	0.684	0.54
34_I	61_E	0.683	0.54
9_R	46_R	0.682	0.54
91_N	101_T	0.681	0.54
22_S	33_I	0.680	0.54
71_N	75_I	0.676	0.53
64_L	104_S	0.667	0.52
58_S	61_E	0.667	0.52
118_L	130_I	0.653	0.51
113_Q	123_S	0.649	0.51
16_K	85_E	0.648	0.50
37_I	134_I	0.646	0.50
124_K	128_N	0.645	0.50
58_S	62_K	0.644	0.50
53_Y	56_L	0.638	0.49
23_L	65_V	0.638	0.49
72_N	77_I	0.635	0.49
58_S	85_E	0.632	0.49
113_Q	117_Y	0.624	0.48
29_R	108_L	0.623	0.48
86_L	93_S	0.623	0.48
32_E	61_E	0.622	0.48
110_E	137_L	0.622	0.48
29_R	45_Y	0.620	0.47
41_F	117_Y	0.618	0.47
43_G	76_Y	0.618	0.47
22_S	52_V	0.618	0.47
36_T	66_E	0.617	0.47
66_E	110_E	0.617	0.47
89_I	122_R	0.608	0.46
11_K	73_K	0.607	0.46
61_E	64_L	0.605	0.46
29_R	75_I	0.603	0.46
48_S	54_P	0.595	0.45
106_Q	116_F	0.590	0.44
32_E	73_K	0.582	0.43
17_Y	37_I	0.580	0.43
15_L	18_L	0.579	0.43
30_T	56_L	0.578	0.43
25_E	28_M	0.577	0.43
81_K	87_Q	0.575	0.43
107_I	111_L	0.574	0.42
117_Y	120_D	0.573	0.42
18_L	22_S	0.571	0.42
84_N	118_L	0.567	0.42
131_Q	135_E	0.565	0.41
21_E	40_K	0.563	0.41
105_R	136_Y	0.562	0.41
100_N	103_F	0.559	0.41
33_I	40_K	0.554	0.40
16_K	41_F	0.551	0.40
114_I	119_Y	0.551	0.40
18_L	41_F	0.549	0.40
124_K	132_K	0.549	0.40
37_I	55_V	0.548	0.40
62_K	85_E	0.547	0.40
31_Y	45_Y	0.542	0.39
17_Y	93_S	0.540	0.39
22_S	30_T	0.536	0.38
12_K	32_E	0.536	0.38
106_Q	109_Q	0.535	0.38
77_I	83_K	0.535	0.38
98_G	135_E	0.530	0.38
55_V	141_R	0.529	0.38
17_Y	86_L	0.528	0.38
124_K	142_N	0.522	0.37
21_E	90_K	0.519	0.37
57_K	74_K	0.516	0.36
107_I	140_C	0.515	0.36
57_K	70_E	0.512	0.36
90_K	98_G	0.509	0.36
39_K	52_V	0.508	0.36
107_I	125_I	0.508	0.36
75_I	134_I	0.507	0.35
73_K	106_Q	0.506	0.35
128_N	131_Q	0.503	0.35
115_A	134_I	0.502	0.35
32_E	99_D	0.502	0.35
69_V	85_E	0.502	0.35
28_M	35_K	0.501	0.35
14_A	26_R	0.500	0.35
136_Y	139_N	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bm9A	2	0.723	99.9	0.524	Contact Map
2rkhA	2	0.8311	99.8	0.584	Contact Map
3l9fA	2	0.8176	99.8	0.592	Contact Map
2zfwA	2	0.6622	99.7	0.599	Contact Map
2e1nA	2	0.6622	99.7	0.611	Contact Map
1xmaA	2	0.6689	99.7	0.614	Contact Map
2eshA	2	0.7365	99.7	0.616	Contact Map
1yg2A	2	0.8243	99.7	0.617	Contact Map
2dqlA	2	0.6824	99.7	0.623	Contact Map
3f8bA	2	0.6757	99.6	0.651	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.