Q981A0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q981A0 - Uncharacterized protein

UniProt:	Q981A0	Sequences: MFWHRRRGLKWLILYVLSKGPMTGAQIMDEIEKTSHGMWRPSPGSIYPALDALESEGLIRISRVDGWKKYYELTEEGRKAIGAMSEEDKIKEAIEQLEFSARYIVENLEKLNDEDKRKVKNILDELSKVMR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	131 (122)
Sequences:	1018 (675)
Seq/√Len:	61.1

ECOLI - YQJI
SULSO - Q981A0 Q981A9 Q7LX63

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_E	78_R	4.378	1.00
13_I	27_I	4.089	1.00
60_R	72_E	3.651	1.00
51_D	55_S	3.097	1.00
19_K	34_T	3.088	1.00
122_I	126_L	2.911	1.00
20_G	26_Q	2.581	1.00
62_S	72_E	2.398	1.00
30_E	33_K	2.225	1.00
61_I	71_Y	2.033	1.00
13_I	46_I	1.957	1.00
18_S	85_S	1.914	1.00
13_I	49_A	1.849	1.00
95_E	124_D	1.797	1.00
80_A	84_M	1.780	0.99
84_M	87_E	1.745	0.99
7_R	10_K	1.690	0.99
96_Q	100_S	1.685	0.99
79_K	83_A	1.683	0.99
123_L	126_L	1.631	0.99
64_V	67_W	1.602	0.99
22_M	30_E	1.599	0.99
61_I	69_K	1.506	0.98
95_E	99_F	1.499	0.98
99_F	124_D	1.493	0.98
62_S	65_D	1.491	0.98
92_E	96_Q	1.469	0.98
82_G	85_S	1.460	0.98
10_K	56_E	1.403	0.97
107_N	111_L	1.399	0.97
50_L	71_Y	1.393	0.97
10_K	49_A	1.384	0.97
79_K	82_G	1.361	0.97
35_S	39_W	1.359	0.97
112_N	115_D	1.355	0.97
45_S	49_A	1.350	0.97
97_L	101_A	1.337	0.96
80_A	83_A	1.331	0.96
111_L	115_D	1.304	0.96
17_L	73_L	1.299	0.96
31_I	34_T	1.292	0.96
49_A	53_L	1.280	0.95
33_K	53_L	1.269	0.95
56_E	73_L	1.233	0.94
18_S	78_R	1.220	0.94
76_E	79_K	1.201	0.93
92_E	95_E	1.188	0.93
100_S	105_V	1.150	0.92
54_E	64_V	1.129	0.91
29_D	40_R	1.114	0.90
115_D	118_K	1.111	0.90
40_R	46_I	1.110	0.90
15_Y	19_K	1.096	0.90
122_I	125_E	1.091	0.90
96_Q	124_D	1.060	0.88
35_S	70_Y	1.051	0.88
120_K	124_D	1.036	0.87
100_S	126_L	1.029	0.87
58_L	80_A	1.001	0.85
93_A	97_L	0.992	0.85
118_K	122_I	0.982	0.84
22_M	26_Q	0.977	0.84
49_A	52_A	0.961	0.83
52_A	80_A	0.956	0.82
97_L	100_S	0.947	0.82
26_Q	68_K	0.942	0.81
92_E	122_I	0.937	0.81
81_I	84_M	0.936	0.81
89_K	97_L	0.929	0.80
89_K	93_A	0.921	0.80
13_I	84_M	0.894	0.78
6_R	45_S	0.891	0.78
7_R	45_S	0.883	0.77
60_R	75_E	0.880	0.77
117_R	124_D	0.877	0.76
6_R	67_W	0.868	0.76
99_F	103_Y	0.862	0.75
16_V	21_P	0.860	0.75
58_L	74_T	0.860	0.75
68_K	105_V	0.846	0.74
113_D	116_K	0.834	0.73
110_K	119_V	0.830	0.72
9_L	12_L	0.823	0.72
52_A	55_S	0.823	0.72
43_P	71_Y	0.821	0.72
76_E	83_A	0.807	0.70
54_E	61_I	0.801	0.70
57_G	76_E	0.791	0.69
5_R	13_I	0.791	0.69
18_S	31_I	0.789	0.69
10_K	67_W	0.783	0.68
54_E	104_I	0.778	0.67
22_M	27_I	0.777	0.67
93_A	98_E	0.774	0.67
11_W	39_W	0.767	0.66
11_W	81_I	0.762	0.66
110_K	115_D	0.761	0.66
23_T	68_K	0.740	0.64
113_D	117_R	0.734	0.63
75_E	82_G	0.733	0.63
116_K	120_K	0.732	0.63
17_L	59_I	0.726	0.62
6_R	13_I	0.726	0.62
8_G	30_E	0.722	0.62
94_I	98_E	0.720	0.61
61_I	68_K	0.719	0.61
5_R	97_L	0.713	0.61
52_A	67_W	0.707	0.60
96_Q	99_F	0.705	0.60
6_R	9_L	0.703	0.60
23_T	39_W	0.699	0.59
14_L	81_I	0.697	0.59
13_I	17_L	0.690	0.58
38_M	71_Y	0.690	0.58
108_L	111_L	0.687	0.58
98_E	101_A	0.686	0.58
30_E	34_T	0.686	0.58
78_R	82_G	0.682	0.57
25_A	29_D	0.680	0.57
8_G	20_G	0.679	0.57
97_L	104_I	0.676	0.57
17_L	22_M	0.669	0.56
75_E	79_K	0.662	0.55
117_R	121_N	0.659	0.55
67_W	72_E	0.657	0.54
121_N	125_E	0.655	0.54
111_L	119_V	0.640	0.53
97_L	105_V	0.640	0.53
23_T	26_Q	0.639	0.52
30_E	60_R	0.635	0.52
7_R	35_S	0.626	0.51
92_E	100_S	0.621	0.50
93_A	116_K	0.613	0.49
67_W	122_I	0.611	0.49
55_S	61_I	0.611	0.49
18_S	75_E	0.606	0.49
6_R	52_A	0.605	0.49
19_K	87_E	0.603	0.48
114_E	117_R	0.600	0.48
46_I	61_I	0.598	0.48
10_K	35_S	0.598	0.48
31_I	38_M	0.596	0.48
89_K	105_V	0.594	0.47
46_I	101_A	0.581	0.46
68_K	71_Y	0.576	0.45
78_R	113_D	0.573	0.45
115_D	119_V	0.572	0.45
93_A	104_I	0.570	0.45
23_T	70_Y	0.569	0.45
47_Y	50_L	0.565	0.44
65_D	72_E	0.560	0.44
106_E	109_E	0.559	0.43
33_K	68_K	0.556	0.43
90_I	93_A	0.555	0.43
40_R	69_K	0.548	0.42
24_G	47_Y	0.544	0.42
98_E	105_V	0.540	0.41
97_L	119_V	0.537	0.41
95_E	104_I	0.535	0.41
28_M	55_S	0.534	0.41
76_E	82_G	0.534	0.41
103_Y	106_E	0.532	0.40
25_A	39_W	0.532	0.40
51_D	69_K	0.531	0.40
15_Y	29_D	0.529	0.40
32_E	40_R	0.528	0.40
32_E	37_G	0.526	0.40
15_Y	34_T	0.526	0.40
15_Y	28_M	0.519	0.39
39_W	81_I	0.518	0.39
104_I	116_K	0.515	0.39
29_D	39_W	0.515	0.39
10_K	52_A	0.515	0.39
15_Y	18_S	0.515	0.39
6_R	26_Q	0.515	0.39
26_Q	45_S	0.515	0.39
7_R	74_T	0.514	0.38
33_K	46_I	0.513	0.38
17_L	111_L	0.511	0.38
15_Y	81_I	0.510	0.38
118_K	126_L	0.501	0.37
5_R	68_K	0.500	0.37
98_E	102_R	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1bm9A	2	0.8015	99.9	0.51	Contact Map
2rkhA	2	0.916	99.8	0.557	Contact Map
3l9fA	2	0.916	99.7	0.577	Contact Map
1yg2A	2	0.8855	99.7	0.591	Contact Map
2zfwA	2	0.7099	99.6	0.615	Contact Map
2e1nA	2	0.7099	99.6	0.622	Contact Map
1xmaA	2	0.7481	99.6	0.627	Contact Map
2eshA	2	0.8244	99.6	0.629	Contact Map
3f8bA	2	0.7481	99.5	0.64	Contact Map
2dqlA	2	0.7328	99.5	0.644	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.