RS8E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS8E - 30S ribosomal protein S8e

UniProt:	Q980W3	Sequences: MGFYQGPDNRKITGGLKGKHRDKRKYEIGNPPTFTTLSAEDIRIKDRTLGGNFKVRLKYTTTANVLDPATNTAKKVKILEILETPANKELARRGIIIRGAKIRTEAGLAVVTSRPGQDGVINAVLLKNESQRS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	133 (108)
Sequences:	397 (234)
Seq/√Len:	22.5

HALSA - RS8E
SULSO - RS8E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_K	15_G	6.927	1.00
80_E	94_G	4.850	1.00
63_A	102_I	3.593	1.00
48_T	52_N	2.769	0.99
63_A	109_A	2.763	0.99
25_K	28_I	2.629	0.99
67_D	70_T	2.491	0.98
76_V	105_E	2.321	0.97
83_E	91_A	2.190	0.96
3_F	28_I	2.135	0.95
74_K	77_K	2.127	0.95
45_K	55_V	2.060	0.94
77_K	105_E	1.944	0.92
37_L	43_R	1.826	0.89
85_P	97_I	1.800	0.89
98_R	101_K	1.723	0.86
66_L	73_A	1.688	0.85
47_R	52_N	1.643	0.84
65_V	106_A	1.618	0.83
62_T	77_K	1.584	0.81
92_R	97_I	1.542	0.79
104_T	107_G	1.491	0.77
33_T	56_R	1.446	0.75
82_L	108_L	1.425	0.74
21_R	24_R	1.417	0.73
29_G	35_T	1.368	0.71
26_Y	49_L	1.355	0.70
61_T	77_K	1.344	0.69
102_I	109_A	1.329	0.68
4_Y	27_E	1.275	0.65
84_T	97_I	1.244	0.63
88_K	91_A	1.226	0.62
10_R	78_I	1.164	0.58
76_V	106_A	1.150	0.57
60_T	96_I	1.149	0.57
7_P	12_I	1.118	0.55
40_E	61_T	1.111	0.54
48_T	53_F	1.106	0.54
12_I	15_G	1.082	0.52
7_P	31_P	1.068	0.51
103_R	108_L	1.059	0.51
50_G	109_A	1.056	0.50
4_Y	33_T	1.045	0.50
39_A	61_T	1.032	0.49
83_E	88_K	1.029	0.49
15_G	20_H	1.026	0.48
5_Q	23_K	1.021	0.48
37_L	78_I	1.003	0.47
5_Q	8_D	0.991	0.46
56_R	92_R	0.990	0.46
84_T	91_A	0.985	0.46
31_P	89_E	0.975	0.45
47_R	51_G	0.962	0.44
4_Y	8_D	0.958	0.44
42_I	88_K	0.945	0.43
22_D	30_N	0.932	0.42
30_N	46_D	0.929	0.42
15_G	74_K	0.915	0.41
70_T	106_A	0.914	0.41
20_H	31_P	0.911	0.41
86_A	109_A	0.908	0.40
97_I	102_I	0.900	0.40
10_R	13_T	0.898	0.40
57_L	72_T	0.875	0.38
74_K	101_K	0.865	0.38
32_P	35_T	0.844	0.36
73_A	96_I	0.844	0.36
27_E	64_N	0.837	0.36
94_G	104_T	0.836	0.36
38_S	42_I	0.829	0.35
25_K	64_N	0.816	0.34
30_N	33_T	0.806	0.34
57_L	64_N	0.801	0.34
9_N	60_T	0.795	0.33
8_D	84_T	0.785	0.33
46_D	56_R	0.775	0.32
29_G	109_A	0.773	0.32
94_G	99_G	0.773	0.32
58_K	73_A	0.754	0.31
7_P	17_K	0.753	0.31
24_R	35_T	0.741	0.30
52_N	102_I	0.739	0.30
29_G	57_L	0.735	0.30
33_T	46_D	0.735	0.30
68_P	103_R	0.729	0.29
12_I	69_A	0.716	0.29
66_L	85_P	0.716	0.29
32_P	54_K	0.708	0.28
9_N	59_Y	0.707	0.28
93_R	104_T	0.703	0.28
75_K	105_E	0.697	0.28
9_N	17_K	0.697	0.28
41_D	59_Y	0.694	0.27
92_R	98_R	0.692	0.27
21_R	28_I	0.691	0.27
91_A	94_G	0.689	0.27
40_E	60_T	0.689	0.27
67_D	106_A	0.685	0.27
24_R	27_E	0.681	0.27
5_Q	30_N	0.675	0.26
4_Y	7_P	0.674	0.26
36_T	95_I	0.671	0.26
23_K	29_G	0.668	0.26
3_F	29_G	0.661	0.26
99_G	107_G	0.651	0.25
71_N	86_A	0.648	0.25
8_D	94_G	0.647	0.25
51_G	78_I	0.646	0.25
87_N	107_G	0.646	0.25
16_L	70_T	0.643	0.25
74_K	105_E	0.642	0.25
82_L	92_R	0.626	0.24
26_Y	82_L	0.626	0.24
76_V	101_K	0.618	0.23
21_R	26_Y	0.617	0.23
62_T	75_K	0.617	0.23
86_A	102_I	0.607	0.23
93_R	107_G	0.605	0.23
34_F	90_L	0.600	0.23
20_H	45_K	0.599	0.22
16_L	67_D	0.599	0.22
23_K	31_P	0.596	0.22
80_E	103_R	0.590	0.22
73_A	81_I	0.589	0.22
79_L	103_R	0.585	0.22
83_E	93_R	0.583	0.22
31_P	99_G	0.583	0.22
15_G	77_K	0.583	0.22
68_P	106_A	0.582	0.22
19_K	40_E	0.578	0.21
45_K	62_T	0.575	0.21
37_L	81_I	0.563	0.21
39_A	76_V	0.560	0.21
7_P	18_G	0.560	0.21
43_R	64_N	0.554	0.20
3_F	22_D	0.554	0.20
90_L	93_R	0.552	0.20
4_Y	65_V	0.551	0.20
97_I	100_A	0.551	0.20
9_N	22_D	0.548	0.20
38_S	61_T	0.547	0.20
6_G	10_R	0.547	0.20
43_R	46_D	0.545	0.20
20_H	71_N	0.544	0.20
10_R	23_K	0.543	0.20
30_N	49_L	0.541	0.20
84_T	99_G	0.536	0.20
64_N	84_T	0.531	0.19
6_G	109_A	0.530	0.19
35_T	57_L	0.525	0.19
31_P	95_I	0.523	0.19
35_T	95_I	0.519	0.19
30_N	84_T	0.517	0.19
16_L	56_R	0.516	0.19
58_K	94_G	0.511	0.19
86_A	100_A	0.510	0.19
98_R	108_L	0.509	0.18
26_Y	73_A	0.504	0.18
9_N	12_I	0.502	0.18
77_K	82_L	0.502	0.18
21_R	27_E	0.500	0.18
50_G	54_K	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kcoA	1	0.9925	100	0.064	Contact Map
4ujpJ	1	0.985	100	0.089	Contact Map
3j20J	1	0.9474	100	0.091	Contact Map
4bpe2	1	0.985	100	0.112	Contact Map
3j60I	1	0.1955	100	0.117	Contact Map
3j7aL	1	0.9699	100	0.137	Contact Map
4w23I	1	0.985	100	0.142	Contact Map
3j38I	1	0.985	100	0.142	Contact Map
3zey5	1	0.985	100	0.148	Contact Map
2kcpA	1	0.7143	100	0.34	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.