PTH - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PTH - Peptidyl-tRNA hydrolase

UniProt:	Q980V1	Sequences: MIKMVIVVRSDIKMGKGKIAAQVAHAAVTLVVSIINSNNLRWKEWLNEWLHQGQPKIIVKVNSLDEIISRAKKAETMNLPFSIIEDAGKTQLEPGTITCLGIGPAPENLVDSITGDLKLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (114)
Sequences:	666 (443)
Seq/√Len:	41.5

HALSA - PTH
SULSO - PTH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_G	91_Q	4.192	1.00
79_L	102_I	3.493	1.00
32_V	50_L	2.947	1.00
29_T	84_I	2.708	1.00
102_I	110_V	2.626	1.00
30_L	101_G	2.588	1.00
63_S	66_E	2.549	1.00
24_A	27_A	2.304	1.00
62_N	66_E	2.210	1.00
6_I	23_V	2.071	0.99
28_V	31_V	1.946	0.99
31_V	46_L	1.875	0.98
77_M	112_S	1.862	0.98
4_M	30_L	1.818	0.98
55_P	89_K	1.749	0.98
71_A	81_F	1.738	0.98
5_V	59_V	1.710	0.97
72_K	76_T	1.698	0.97
4_M	27_A	1.632	0.96
20_A	23_V	1.587	0.96
29_T	82_S	1.572	0.95
61_V	66_E	1.543	0.95
23_V	99_C	1.524	0.95
70_R	100_L	1.513	0.94
55_P	107_E	1.491	0.94
71_A	75_E	1.482	0.94
85_E	97_I	1.476	0.94
106_P	109_L	1.472	0.94
8_V	23_V	1.447	0.93
77_M	113_I	1.432	0.93
83_I	100_L	1.408	0.92
79_L	110_V	1.400	0.92
79_L	113_I	1.361	0.91
16_K	91_Q	1.346	0.90
107_E	111_D	1.309	0.89
9_R	64_L	1.304	0.89
92_L	96_T	1.290	0.88
64_L	97_I	1.270	0.87
7_V	61_V	1.267	0.87
14_M	19_I	1.225	0.85
8_V	19_I	1.223	0.85
69_S	73_K	1.220	0.85
15_G	58_I	1.193	0.84
85_E	95_G	1.191	0.83
12_I	96_T	1.171	0.82
10_S	13_K	1.143	0.81
6_I	99_C	1.130	0.80
14_M	21_A	1.129	0.80
9_R	96_T	1.122	0.80
2_I	107_E	1.116	0.79
7_V	100_L	1.092	0.78
21_A	89_K	1.086	0.77
105_A	109_L	1.058	0.75
46_L	50_L	1.053	0.75
33_S	84_I	1.037	0.74
58_I	108_N	1.029	0.73
16_K	118_K	1.008	0.72
9_R	61_V	0.975	0.69
79_L	105_A	0.972	0.69
64_L	68_I	0.968	0.69
5_V	102_I	0.954	0.68
11_D	103_G	0.942	0.67
61_V	67_I	0.928	0.65
19_I	23_V	0.922	0.65
34_I	80_P	0.918	0.65
45_W	80_P	0.916	0.64
8_V	99_C	0.909	0.64
4_M	82_S	0.905	0.63
69_S	75_E	0.901	0.63
57_I	89_K	0.892	0.62
30_L	80_P	0.879	0.61
60_K	92_L	0.867	0.60
91_Q	118_K	0.852	0.59
5_V	8_V	0.849	0.58
10_S	63_S	0.838	0.57
32_V	46_L	0.835	0.57
31_V	50_L	0.831	0.57
30_L	34_I	0.824	0.56
10_S	62_N	0.817	0.56
8_V	89_K	0.813	0.55
59_V	70_R	0.806	0.55
68_I	97_I	0.794	0.53
45_W	106_P	0.793	0.53
14_M	92_L	0.793	0.53
18_K	90_T	0.790	0.53
10_S	60_K	0.786	0.53
7_V	59_V	0.782	0.52
46_L	99_C	0.782	0.52
73_K	77_M	0.782	0.52
18_K	88_G	0.780	0.52
58_I	105_A	0.775	0.52
52_Q	107_E	0.763	0.50
13_K	94_P	0.750	0.49
79_L	109_L	0.747	0.49
47_N	76_T	0.743	0.49
92_L	95_G	0.743	0.49
70_R	116_D	0.739	0.48
57_I	73_K	0.738	0.48
102_I	114_T	0.727	0.47
75_E	81_F	0.722	0.47
14_M	17_G	0.714	0.46
24_A	43_K	0.705	0.45
89_K	94_P	0.704	0.45
58_I	67_I	0.703	0.45
33_S	82_S	0.702	0.45
38_N	48_E	0.701	0.45
89_K	99_C	0.700	0.45
73_K	76_T	0.697	0.44
74_A	102_I	0.697	0.44
59_V	117_L	0.687	0.43
10_S	84_I	0.684	0.43
103_G	110_V	0.682	0.43
71_A	83_I	0.682	0.43
11_D	64_L	0.675	0.42
77_M	111_D	0.669	0.42
34_I	38_N	0.665	0.41
76_T	81_F	0.664	0.41
69_S	76_T	0.658	0.41
87_A	90_T	0.655	0.41
47_N	108_N	0.647	0.40
80_P	113_I	0.645	0.40
67_I	97_I	0.637	0.39
7_V	114_T	0.635	0.39
108_N	112_S	0.633	0.39
21_A	24_A	0.627	0.38
8_V	58_I	0.626	0.38
9_R	103_G	0.623	0.38
26_A	101_G	0.620	0.37
2_I	27_A	0.618	0.37
48_E	52_Q	0.613	0.37
88_G	91_Q	0.609	0.36
36_N	73_K	0.609	0.36
53_G	87_A	0.603	0.36
64_L	92_L	0.602	0.36
55_P	105_A	0.600	0.36
66_E	101_G	0.599	0.36
91_Q	96_T	0.594	0.35
45_W	109_L	0.594	0.35
63_S	113_I	0.586	0.34
4_M	80_P	0.585	0.34
64_L	85_E	0.576	0.34
28_V	81_F	0.573	0.33
35_I	65_D	0.570	0.33
106_P	118_K	0.569	0.33
14_M	64_L	0.568	0.33
5_V	110_V	0.565	0.33
77_M	109_L	0.565	0.33
48_E	78_N	0.563	0.33
70_R	117_L	0.559	0.32
11_D	63_S	0.556	0.32
63_S	68_I	0.556	0.32
43_K	74_A	0.552	0.32
7_V	113_I	0.549	0.31
70_R	111_D	0.546	0.31
60_K	107_E	0.542	0.31
4_M	99_C	0.541	0.31
104_P	110_V	0.539	0.31
22_Q	88_G	0.538	0.31
66_E	69_S	0.536	0.30
81_F	102_I	0.535	0.30
54_Q	106_P	0.533	0.30
71_A	100_L	0.531	0.30
34_I	45_W	0.527	0.30
34_I	43_K	0.525	0.30
63_S	73_K	0.520	0.29
53_G	95_G	0.513	0.29
102_I	113_I	0.508	0.28
60_K	91_Q	0.507	0.28
6_I	58_I	0.504	0.28
12_I	65_D	0.502	0.28
58_I	95_G	0.500	0.28

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xtyA	2	1	100	0.144	Contact Map
2zv3A	2	0.9583	100	0.155	Contact Map
1q7sA	2	0.9667	100	0.156	Contact Map
1rlkA	2	0.9667	100	0.162	Contact Map
1wn2A	2	0.9667	100	0.163	Contact Map
1rzwA	1	0.9417	100	0.177	Contact Map
2gaxA	2	0.9083	99.8	0.598	Contact Map
2lndA	1	0.8417	28.6	0.935	Contact Map
1xbiA	1	0.9083	23.2	0.938	Contact Map
4jb1A	1	0.6417	22.8	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.