Q980U3 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980U3 - Uroporphyrinogen III synthase, putative

UniProt:	Q980U3	Sequences: MRVLFLRPDNEDNELNEKLMILRKNGIEVLNIPIFKIKCVSYSLPTYDYEALAFTSRNSVICFKDRTLIKNVHKIYAIGEETAELLMKMYNVNPITPERFTSIELAKRILEDKVNSILSIRSRKASEDMRNILNGKIKYDEIYVYDSEIIRDNINEISKILTECEVDAIAFTSSLMAKLIGPFIRGKCNIIIFSIGPMTTETLKRVNNKVKIIESKTHSIKGIIETILVEMKRNGRD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	237 (224)
Sequences:	4402 (3358)
Seq/√Len:	224.4

ECOLI - HEM4
BACSU - HEM4 YJJA NASF
HALSA - Q9HMY3
SULSO - Q980U3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_L	24_K	3.977	1.00
194_S	200_T	3.727	1.00
123_R	146_D	3.417	1.00
49_Y	140_D	3.412	1.00
174_S	202_T	2.906	1.00
200_T	214_E	2.726	1.00
121_R	141_E	2.573	1.00
116_S	138_K	2.559	1.00
51_A	76_Y	2.447	1.00
132_I	135_G	2.401	1.00
178_K	202_T	2.340	1.00
168_A	193_F	2.322	1.00
77_A	83_A	2.297	1.00
35_F	148_E	2.239	1.00
49_Y	118_L	2.196	1.00
35_F	146_D	2.161	1.00
18_K	22_L	2.135	1.00
50_E	115_N	2.083	1.00
106_A	132_I	2.073	1.00
177_A	203_L	1.983	1.00
61_I	85_L	1.947	1.00
33_P	150_I	1.924	1.00
16_N	28_E	1.907	1.00
150_I	179_L	1.873	1.00
192_I	208_N	1.861	1.00
54_F	60_V	1.852	1.00
194_S	203_L	1.820	1.00
194_S	214_E	1.769	1.00
95_I	108_R	1.765	1.00
85_L	88_K	1.758	1.00
121_R	125_A	1.749	1.00
75_I	91_N	1.719	1.00
18_K	221_K	1.710	1.00
34_I	147_S	1.700	1.00
51_A	74_K	1.670	1.00
51_A	117_I	1.665	1.00
127_E	131_N	1.641	1.00
22_L	228_L	1.633	1.00
201_E	204_K	1.632	1.00
200_T	204_K	1.623	1.00
168_A	227_I	1.617	1.00
181_G	206_V	1.615	1.00
171_F	180_I	1.608	1.00
5_F	16_N	1.608	1.00
36_K	62_C	1.577	1.00
102_S	129_M	1.561	1.00
16_N	26_G	1.561	1.00
101_T	104_E	1.556	1.00
201_E	205_R	1.551	1.00
43_S	46_T	1.539	1.00
54_F	63_F	1.524	1.00
34_I	58_N	1.518	1.00
11_E	58_N	1.497	1.00
116_S	140_D	1.483	1.00
130_R	134_N	1.469	1.00
99_R	104_E	1.463	1.00
213_I	226_T	1.456	1.00
193_F	213_I	1.446	1.00
62_C	144_V	1.434	1.00
192_I	203_L	1.433	1.00
195_I	199_T	1.427	1.00
76_Y	105_L	1.423	1.00
218_H	222_G	1.404	1.00
171_F	177_A	1.401	1.00
4_L	166_V	1.396	1.00
178_K	206_V	1.382	1.00
33_P	148_E	1.363	1.00
215_S	222_G	1.339	1.00
196_G	199_T	1.332	1.00
170_A	223_I	1.330	1.00
130_R	141_E	1.324	1.00
217_T	222_G	1.324	1.00
202_T	205_R	1.322	1.00
50_E	116_S	1.308	1.00
103_I	126_S	1.288	1.00
57_R	81_E	1.286	1.00
123_R	143_Y	1.277	1.00
172_T	176_M	1.268	1.00
17_E	21_I	1.265	1.00
131_N	134_N	1.251	1.00
203_L	210_V	1.249	1.00
77_A	86_L	1.246	1.00
168_A	191_I	1.242	1.00
171_F	192_I	1.242	1.00
203_L	208_N	1.238	1.00
48_D	116_S	1.233	1.00
98_E	108_R	1.232	1.00
5_F	12_D	1.231	1.00
16_N	20_M	1.223	1.00
17_E	20_M	1.218	1.00
74_K	94_P	1.209	1.00
193_F	223_I	1.209	1.00
83_A	87_M	1.191	1.00
149_I	182_P	1.188	1.00
191_I	213_I	1.183	1.00
19_L	26_G	1.181	1.00
31_N	179_L	1.127	1.00
197_P	218_H	1.117	1.00
27_I	166_V	1.110	1.00
102_S	106_A	1.108	1.00
20_M	26_G	1.081	1.00
117_I	137_I	1.069	1.00
160_I	165_E	1.064	1.00
53_A	109_I	1.055	1.00
119_S	130_R	1.055	1.00
174_S	198_M	1.049	1.00
155_N	159_K	1.049	1.00
18_K	21_I	1.043	1.00
219_S	222_G	1.039	1.00
52_L	120_I	1.031	1.00
147_S	175_L	1.029	1.00
77_A	96_T	1.025	1.00
202_T	206_V	1.021	1.00
125_A	141_E	1.012	1.00
52_L	75_I	1.006	1.00
159_K	163_E	0.988	1.00
87_M	92_V	0.987	1.00
57_R	85_L	0.982	1.00
149_I	179_L	0.969	1.00
158_S	162_T	0.969	1.00
128_D	132_I	0.961	1.00
9_D	13_N	0.959	1.00
124_K	175_L	0.957	1.00
103_I	128_D	0.947	1.00
13_N	28_E	0.938	1.00
156_E	160_I	0.938	1.00
9_D	12_D	0.935	1.00
185_R	188_C	0.931	1.00
84_E	88_K	0.913	0.99
34_I	62_C	0.913	0.99
181_G	208_N	0.912	0.99
51_A	95_I	0.911	0.99
33_P	151_R	0.910	0.99
67_T	70_K	0.892	0.99
108_R	112_D	0.886	0.99
131_N	135_G	0.886	0.99
114_V	137_I	0.882	0.99
31_N	180_I	0.882	0.99
59_S	119_S	0.882	0.99
95_I	105_L	0.880	0.99
60_V	85_L	0.880	0.99
15_L	170_A	0.874	0.99
45_P	140_D	0.871	0.99
37_I	146_D	0.870	0.99
3_V	168_A	0.867	0.99
81_E	84_E	0.865	0.99
156_E	159_K	0.857	0.99
191_I	211_K	0.852	0.99
32_I	147_S	0.845	0.99
174_S	199_T	0.844	0.99
78_I	105_L	0.842	0.99
61_I	88_K	0.832	0.99
59_S	120_I	0.827	0.99
32_I	179_L	0.827	0.99
179_L	183_F	0.824	0.99
170_A	227_I	0.819	0.99
170_A	193_F	0.816	0.99
134_N	139_Y	0.816	0.99
37_I	40_V	0.816	0.99
53_A	105_L	0.814	0.99
86_L	91_N	0.812	0.99
83_A	96_T	0.809	0.99
85_L	89_M	0.808	0.99
54_F	75_I	0.808	0.99
58_N	62_C	0.808	0.99
31_N	183_F	0.807	0.99
101_T	197_P	0.806	0.99
63_F	120_I	0.802	0.99
80_E	100_F	0.800	0.99
118_L	142_I	0.800	0.99
87_M	93_N	0.798	0.99
60_V	82_T	0.796	0.99
120_I	144_V	0.794	0.99
225_E	229_V	0.792	0.99
102_S	128_D	0.785	0.98
197_P	201_E	0.784	0.98
110_L	132_I	0.783	0.98
13_N	17_E	0.777	0.98
5_F	19_L	0.776	0.98
97_P	100_F	0.773	0.98
203_L	207_N	0.772	0.98
172_T	220_I	0.765	0.98
197_P	214_E	0.755	0.98
122_S	143_Y	0.753	0.98
77_A	93_N	0.751	0.98
63_F	144_V	0.749	0.98
84_E	87_M	0.748	0.98
37_I	143_Y	0.744	0.98
100_F	104_E	0.740	0.98
74_K	112_D	0.738	0.98
216_K	225_E	0.738	0.98
104_E	107_K	0.736	0.98
222_G	226_T	0.736	0.98
133_L	137_I	0.735	0.98
9_D	28_E	0.733	0.98
193_F	226_T	0.732	0.98
124_K	147_S	0.721	0.97
100_F	219_S	0.720	0.97
7_R	176_M	0.714	0.97
32_I	175_L	0.714	0.97
5_F	170_A	0.709	0.97
76_Y	108_R	0.708	0.97
107_K	132_I	0.707	0.97
78_I	102_S	0.707	0.97
58_N	61_I	0.706	0.97
169_I	190_I	0.705	0.97
27_I	160_I	0.702	0.97
53_A	76_Y	0.700	0.97
45_P	48_D	0.698	0.97
52_L	118_L	0.696	0.97
5_F	26_G	0.695	0.97
225_E	228_L	0.695	0.97
119_S	139_Y	0.694	0.97
5_F	28_E	0.693	0.97
226_T	229_V	0.693	0.97
32_I	173_S	0.692	0.97
75_I	86_L	0.691	0.96
51_A	108_R	0.689	0.96
152_D	183_F	0.688	0.96
126_S	198_M	0.686	0.96
105_L	109_I	0.685	0.96
169_I	192_I	0.681	0.96
12_D	28_E	0.680	0.96
51_A	115_N	0.679	0.96
128_D	131_N	0.677	0.96
204_K	209_K	0.672	0.96
121_R	127_E	0.670	0.96
15_L	19_L	0.667	0.96
164_C	189_N	0.657	0.95
60_V	86_L	0.655	0.95
106_A	109_I	0.653	0.95
51_A	109_I	0.653	0.95
127_E	141_E	0.649	0.95
90_Y	93_N	0.648	0.95
195_I	215_S	0.645	0.95
102_S	147_S	0.645	0.95
7_R	11_E	0.644	0.95
210_V	213_I	0.643	0.95
54_F	120_I	0.642	0.95
216_K	226_T	0.638	0.95
5_F	10_N	0.636	0.94
91_N	94_P	0.632	0.94
215_S	226_T	0.630	0.94
124_K	143_Y	0.627	0.94
119_S	129_M	0.626	0.94
74_K	115_N	0.623	0.94
34_I	57_R	0.623	0.94
182_P	185_R	0.621	0.94
159_K	162_T	0.620	0.94
11_E	57_R	0.617	0.94
24_K	228_L	0.617	0.94
106_A	110_L	0.616	0.93
15_L	172_T	0.612	0.93
121_R	130_R	0.609	0.93
115_N	137_I	0.608	0.93
56_S	82_T	0.608	0.93
134_N	138_K	0.605	0.93
120_I	142_I	0.604	0.93
54_F	82_T	0.603	0.93
29_V	152_D	0.600	0.93
78_I	82_T	0.597	0.92
50_E	71_N	0.595	0.92
109_I	112_D	0.594	0.92
80_E	219_S	0.593	0.92
106_A	129_M	0.592	0.92
124_K	178_K	0.592	0.92
100_F	218_H	0.588	0.92
76_Y	97_P	0.588	0.92
178_K	205_R	0.587	0.92
13_N	62_C	0.587	0.92
83_A	93_N	0.586	0.92
95_I	110_L	0.586	0.92
122_S	198_M	0.585	0.92
20_M	25_N	0.584	0.92
18_K	224_I	0.583	0.91
193_F	227_I	0.582	0.91
175_L	196_G	0.579	0.91
101_T	198_M	0.579	0.91
197_P	204_K	0.579	0.91
53_A	129_M	0.578	0.91
29_V	154_I	0.578	0.91
215_S	218_H	0.578	0.91
178_K	182_P	0.576	0.91
31_N	171_F	0.576	0.91
101_T	218_H	0.574	0.91
122_S	144_V	0.569	0.90
6_L	176_M	0.566	0.90
98_E	104_E	0.564	0.90
31_N	150_I	0.563	0.90
20_M	28_E	0.561	0.90
121_R	143_Y	0.561	0.90
106_A	128_D	0.559	0.90
119_S	141_E	0.554	0.89
177_A	206_V	0.552	0.89
8_P	34_I	0.551	0.89
23_R	26_G	0.550	0.89
168_A	213_I	0.546	0.89
211_K	214_E	0.545	0.89
161_L	166_V	0.544	0.88
104_E	108_R	0.543	0.88
7_R	82_T	0.542	0.88
216_K	229_V	0.540	0.88
38_K	42_Y	0.540	0.88
3_V	6_L	0.539	0.88
192_I	210_V	0.538	0.88
67_T	71_N	0.535	0.88
119_S	172_T	0.535	0.88
150_I	153_N	0.535	0.88
53_A	133_L	0.533	0.87
32_I	176_M	0.531	0.87
14_E	17_E	0.530	0.87
224_I	228_L	0.529	0.87
216_K	222_G	0.527	0.87
125_A	198_M	0.527	0.87
222_G	225_E	0.525	0.87
76_Y	95_I	0.524	0.87
55_T	59_S	0.522	0.86
7_R	126_S	0.522	0.86
14_E	18_K	0.521	0.86
217_T	225_E	0.520	0.86
119_S	125_A	0.520	0.86
78_I	122_S	0.518	0.86
171_F	176_M	0.518	0.86
12_D	16_N	0.518	0.86
54_F	119_S	0.517	0.86
147_S	179_L	0.516	0.86
107_K	111_E	0.516	0.86
11_E	14_E	0.511	0.85
9_D	15_L	0.509	0.85
215_S	219_S	0.508	0.85
53_A	137_I	0.505	0.84
126_S	147_S	0.503	0.84
5_F	15_L	0.502	0.84
102_S	126_S	0.501	0.84
194_S	220_I	0.501	0.84
200_T	211_K	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3re1A	1	0.9916	100	0.164	Contact Map
3d8tA	1	0.962	100	0.176	Contact Map
1wcwA	1	0.9705	100	0.178	Contact Map
1jr2A	1	0.962	100	0.181	Contact Map
3mw8A	1	0.9451	100	0.183	Contact Map
4es6A	1	0.962	100	0.185	Contact Map
3p9zA	1	0.8481	100	0.263	Contact Map
2cukA	2	0.9325	95.3	0.885	Contact Map
3qk7A	2	0.9662	95.2	0.886	Contact Map
3egcA	2	0.9451	95.1	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0082 seconds.