Y193 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y193 - Protein SSO0193

UniProt:	Q980T4	Sequences: MIQEELVQIQELNEEIGRLLIEIARKSIKEEFKLDKLDLSKYDNPILDKKGLAFVTLEKIAYNTSSLRGCIGYVEAVAPLKQIAASAAKAAAFSDPRFNPLQEDELANIIIEVTVLTKPEEIKVKDRWDLPKIIKVGEDGLIVEKGILHSGLLLPQVPMEYCWDEETFLAETCIKASLEPDCWLDSSVRIKRFHGIIFKETKPNGSDIIVIKPSDIKCKLNELINNL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	227 (175)
Sequences:	1075 (878)
Seq/√Len:	66.3

HALSA - Y2543
SULSO - Y193

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
152_L	193_F	5.625	1.00
101_L	109_I	3.755	1.00
114_T	195_G	3.509	1.00
119_P	142_I	3.441	1.00
153_L	171_E	3.179	1.00
20_L	84_A	2.981	1.00
89_K	93_F	2.971	1.00
144_E	150_S	2.923	1.00
144_E	189_R	2.866	1.00
57_L	101_L	2.864	1.00
28_I	92_A	2.775	1.00
120_E	192_R	2.758	1.00
164_D	167_T	2.718	1.00
117_T	194_H	2.479	1.00
59_K	108_N	2.342	1.00
138_E	194_H	2.335	1.00
144_E	191_K	2.299	1.00
121_E	189_R	2.248	1.00
74_V	152_L	2.209	1.00
139_D	194_H	2.061	1.00
31_E	93_F	2.022	1.00
78_A	86_S	1.915	1.00
28_I	111_I	1.872	1.00
153_L	172_T	1.807	1.00
135_K	138_E	1.727	1.00
139_D	192_R	1.719	1.00
24_A	84_A	1.708	0.99
90_A	94_S	1.679	0.99
112_E	156_Q	1.678	0.99
158_P	168_F	1.649	0.99
156_Q	195_G	1.625	0.99
158_P	163_W	1.612	0.99
31_E	89_K	1.580	0.99
143_V	172_T	1.565	0.99
53_A	152_L	1.561	0.99
23_I	85_A	1.556	0.99
28_I	88_A	1.536	0.99
130_L	190_I	1.513	0.99
25_R	200_E	1.483	0.99
53_A	83_I	1.474	0.98
30_E	34_L	1.460	0.98
135_K	139_D	1.419	0.98
32_F	93_F	1.411	0.98
93_F	101_L	1.395	0.98
39_L	42_Y	1.353	0.97
173_C	182_C	1.320	0.97
74_V	193_F	1.311	0.97
86_S	94_S	1.306	0.97
131_P	166_E	1.302	0.97
117_T	196_I	1.288	0.96
68_R	105_E	1.287	0.96
32_F	103_E	1.286	0.96
33_K	103_E	1.283	0.96
23_I	27_S	1.273	0.96
74_V	142_I	1.255	0.96
28_I	93_F	1.246	0.96
53_A	80_L	1.238	0.96
75_E	150_S	1.235	0.95
27_S	85_A	1.232	0.95
120_E	194_H	1.212	0.95
17_G	196_I	1.160	0.94
84_A	115_V	1.148	0.93
143_V	190_I	1.136	0.93
21_I	113_V	1.132	0.93
58_E	112_E	1.130	0.93
64_T	108_N	1.128	0.93
29_K	33_K	1.126	0.93
27_S	89_K	1.114	0.92
29_K	106_L	1.105	0.92
145_K	188_V	1.104	0.92
57_L	111_I	1.076	0.91
121_E	191_K	1.067	0.90
141_L	172_T	1.053	0.90
173_C	188_V	1.045	0.90
56_T	157_V	1.039	0.89
145_K	187_S	1.038	0.89
32_F	101_L	1.032	0.89
161_Y	171_E	1.022	0.88
158_P	162_C	1.016	0.88
73_Y	77_V	1.015	0.88
173_C	176_A	0.995	0.87
133_I	192_R	0.989	0.87
48_D	81_K	0.983	0.86
57_L	109_I	0.977	0.86
141_L	151_G	0.975	0.86
23_I	84_A	0.949	0.84
99_N	141_L	0.932	0.83
27_S	30_E	0.930	0.83
131_P	169_L	0.930	0.83
145_K	182_C	0.920	0.83
112_E	197_I	0.916	0.82
52_L	76_A	0.914	0.82
16_I	46_I	0.911	0.82
135_K	165_E	0.909	0.82
59_K	109_I	0.893	0.81
136_V	165_E	0.884	0.80
55_V	87_A	0.875	0.79
17_G	113_V	0.874	0.79
153_L	161_Y	0.864	0.78
170_A	190_I	0.856	0.78
56_T	114_T	0.855	0.78
170_A	180_P	0.854	0.78
89_K	110_I	0.852	0.77
86_S	90_A	0.846	0.77
122_I	192_R	0.843	0.77
21_I	25_R	0.840	0.76
78_A	83_I	0.834	0.76
134_I	139_D	0.831	0.76
149_H	176_A	0.827	0.75
102_Q	176_A	0.825	0.75
27_S	88_A	0.821	0.75
123_K	133_I	0.817	0.74
73_Y	78_A	0.816	0.74
153_L	193_F	0.814	0.74
37_L	89_K	0.812	0.74
32_F	106_L	0.804	0.73
58_E	160_E	0.800	0.73
54_F	71_I	0.796	0.72
81_K	84_A	0.793	0.72
113_V	143_V	0.793	0.72
170_A	181_D	0.792	0.72
27_S	84_A	0.792	0.72
22_E	200_E	0.790	0.72
65_S	110_I	0.787	0.72
134_I	165_E	0.777	0.71
52_L	83_I	0.772	0.70
83_I	87_A	0.763	0.69
114_T	157_V	0.761	0.69
32_F	111_I	0.754	0.68
23_I	81_K	0.752	0.68
169_L	190_I	0.751	0.68
91_A	105_E	0.740	0.67
167_T	171_E	0.739	0.67
76_A	119_P	0.733	0.66
144_E	147_I	0.730	0.66
157_V	168_F	0.727	0.66
49_K	80_L	0.726	0.65
18_R	198_F	0.724	0.65
73_Y	87_A	0.720	0.65
130_L	133_I	0.715	0.64
161_Y	172_T	0.712	0.64
141_L	192_R	0.711	0.64
145_K	185_D	0.709	0.64
18_R	22_E	0.708	0.63
158_P	172_T	0.702	0.63
59_K	106_L	0.701	0.63
26_K	35_D	0.697	0.62
43_D	46_I	0.690	0.61
57_L	92_A	0.689	0.61
98_F	154_L	0.689	0.61
112_E	117_T	0.687	0.61
166_E	170_A	0.684	0.61
179_E	182_C	0.682	0.61
115_V	196_I	0.682	0.61
28_I	31_E	0.672	0.59
59_K	101_L	0.666	0.59
106_L	109_I	0.665	0.59
156_Q	197_I	0.664	0.59
114_T	156_Q	0.662	0.58
152_L	172_T	0.661	0.58
122_I	133_I	0.660	0.58
51_G	196_I	0.660	0.58
59_K	102_Q	0.659	0.58
158_P	165_E	0.656	0.58
110_I	199_K	0.655	0.57
58_E	199_K	0.654	0.57
145_K	181_D	0.654	0.57
182_C	188_V	0.651	0.57
136_V	163_W	0.650	0.57
134_I	141_L	0.647	0.57
93_F	103_E	0.647	0.57
151_G	190_I	0.646	0.56
122_I	130_L	0.644	0.56
52_L	198_F	0.636	0.55
103_E	123_K	0.636	0.55
25_R	29_K	0.635	0.55
173_C	184_L	0.634	0.55
74_V	83_I	0.632	0.55
17_G	200_E	0.629	0.54
97_R	154_L	0.628	0.54
143_V	161_Y	0.627	0.54
24_A	27_S	0.626	0.54
19_L	44_N	0.623	0.54
130_L	158_P	0.621	0.54
169_L	176_A	0.621	0.54
188_V	195_G	0.620	0.53
70_C	175_K	0.620	0.53
178_L	183_W	0.614	0.53
70_C	157_V	0.614	0.53
27_S	94_S	0.607	0.52
28_I	151_G	0.605	0.52
14_E	17_G	0.603	0.51
58_E	195_G	0.603	0.51
26_K	30_E	0.602	0.51
58_E	110_I	0.601	0.51
27_S	196_I	0.601	0.51
87_A	163_W	0.599	0.51
131_P	165_E	0.598	0.51
32_F	92_A	0.598	0.51
49_K	102_Q	0.595	0.50
103_E	179_E	0.594	0.50
31_E	36_K	0.594	0.50
88_A	93_F	0.591	0.50
81_K	113_V	0.587	0.50
144_E	181_D	0.586	0.49
137_G	163_W	0.585	0.49
74_V	119_P	0.585	0.49
135_K	194_H	0.585	0.49
30_E	33_K	0.583	0.49
29_K	35_D	0.582	0.49
44_N	81_K	0.576	0.48
15_E	26_K	0.576	0.48
182_C	187_S	0.575	0.48
100_P	120_E	0.575	0.48
179_E	187_S	0.573	0.48
15_E	42_Y	0.572	0.48
20_L	47_L	0.570	0.48
112_E	176_A	0.566	0.47
134_I	168_F	0.565	0.47
99_N	164_D	0.564	0.47
121_E	179_E	0.563	0.47
67_L	97_R	0.562	0.47
76_A	117_T	0.559	0.46
153_L	157_V	0.554	0.46
40_S	44_N	0.554	0.46
169_L	173_C	0.553	0.46
52_L	74_V	0.552	0.45
113_V	198_F	0.550	0.45
110_I	200_E	0.549	0.45
54_F	157_V	0.548	0.45
30_E	35_D	0.546	0.45
87_A	142_I	0.546	0.45
162_C	165_E	0.545	0.45
21_I	200_E	0.545	0.45
87_A	90_A	0.537	0.44
96_P	153_L	0.536	0.44
28_I	90_A	0.534	0.43
68_R	91_A	0.533	0.43
97_R	116_L	0.528	0.43
16_I	47_L	0.526	0.42
122_I	136_V	0.526	0.42
168_F	172_T	0.525	0.42
109_I	200_E	0.523	0.42
36_K	40_S	0.523	0.42
145_K	149_H	0.522	0.42
53_A	87_A	0.518	0.41
54_F	70_C	0.513	0.41
130_L	141_L	0.512	0.41
136_V	162_C	0.512	0.41
26_K	29_K	0.511	0.41
78_A	82_Q	0.511	0.41
55_V	193_F	0.510	0.41
54_F	97_R	0.508	0.40
68_R	98_F	0.507	0.40
153_L	158_P	0.506	0.40
32_F	102_Q	0.504	0.40
35_D	186_S	0.503	0.40
14_E	107_A	0.502	0.40
131_P	136_V	0.501	0.40
43_D	81_K	0.501	0.40
17_G	198_F	0.500	0.39
173_C	190_I	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wscA	1	0.9692	100	0.159	Contact Map
1zq7A	4	0.8811	100	0.18	Contact Map
1vajA	1	0.8855	100	0.183	Contact Map
2d2rA	2	0.3348	19.8	0.959	Contact Map
1hbnA	2	0.2687	7.3	0.966	Contact Map
3ewtE	1	0.0617	5.7	0.968	Contact Map
1k5nA	1	0.5022	5.5	0.968	Contact Map
2l2nA	1	0.2687	5.5	0.968	Contact Map
4j4rA	3	0.4053	5.3	0.969	Contact Map
2og0A	1	0.207	5.3	0.969	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.