Q980R4 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980R4 - Transcription termination factor nusA homolog, putative (NusA)

UniProt:	Q980R4	Sequences: MTRANVRDCIIDNENNRIIFLVDSKDMGVAIGKSGINVKKLKKIIGKDIELVAYSDNLEELVKNLMSPARVRSVKVVNTSSKKSVYINIDPQDKGLAIGKNGRNVARAKLILKRYMDIDNVVIV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	124 (103)
Sequences:	1829 (1374)
Seq/√Len:	135.4

SULSO - Q980R4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_M	74_V	3.434	1.00
40_K	44_I	3.313	1.00
98_I	102_G	3.138	1.00
107_R	111_I	3.072	1.00
31_I	35_G	2.849	1.00
70_R	74_V	2.642	1.00
72_R	75_K	2.412	1.00
76_V	79_T	2.311	1.00
27_M	52_V	2.264	1.00
104_N	107_R	2.093	1.00
67_S	70_R	1.987	1.00
64_N	75_K	1.965	1.00
69_A	73_S	1.898	1.00
62_V	66_M	1.807	1.00
39_K	42_K	1.735	1.00
70_R	73_S	1.700	1.00
71_V	74_V	1.677	1.00
70_R	75_K	1.636	1.00
47_K	70_R	1.599	1.00
46_G	70_R	1.553	1.00
68_P	72_R	1.552	1.00
33_K	36_I	1.542	1.00
64_N	74_V	1.518	1.00
91_P	94_K	1.445	1.00
41_L	45_I	1.412	1.00
107_R	110_L	1.408	1.00
65_L	70_R	1.386	1.00
100_K	103_R	1.364	1.00
61_L	66_M	1.332	1.00
65_L	68_P	1.326	1.00
27_M	60_E	1.319	1.00
18_I	75_K	1.297	1.00
19_I	61_L	1.276	1.00
41_L	49_I	1.266	1.00
63_K	66_M	1.237	1.00
62_V	65_L	1.218	1.00
68_P	73_S	1.206	1.00
61_L	65_L	1.198	1.00
98_I	104_N	1.177	0.99
99_G	102_G	1.173	0.99
98_I	105_V	1.171	0.99
78_N	88_N	1.166	0.99
63_K	67_S	1.146	0.99
18_I	71_V	1.133	0.99
61_L	69_A	1.122	0.99
67_S	73_S	1.120	0.99
32_G	35_G	1.106	0.99
109_K	115_Y	1.098	0.99
95_G	102_G	1.090	0.99
25_K	81_S	1.061	0.99
66_M	69_A	1.046	0.99
43_K	113_K	1.032	0.99
91_P	110_L	0.995	0.98
64_N	68_P	0.971	0.98
16_N	42_K	0.969	0.98
85_V	88_N	0.969	0.98
46_G	85_V	0.956	0.98
54_Y	107_R	0.954	0.98
60_E	64_N	0.945	0.97
51_L	62_V	0.933	0.97
64_N	71_V	0.924	0.97
27_M	41_L	0.914	0.97
38_V	42_K	0.909	0.97
105_V	109_K	0.893	0.96
66_M	71_V	0.869	0.96
87_I	112_L	0.833	0.95
68_P	75_K	0.828	0.95
52_V	94_K	0.803	0.94
92_Q	96_L	0.799	0.93
77_V	81_S	0.795	0.93
22_V	96_L	0.791	0.93
104_N	109_K	0.784	0.93
14_E	91_P	0.778	0.93
78_N	82_K	0.778	0.93
20_F	52_V	0.777	0.92
62_V	68_P	0.773	0.92
99_G	105_V	0.773	0.92
34_S	39_K	0.763	0.92
14_E	68_P	0.761	0.92
89_I	93_D	0.761	0.92
71_V	75_K	0.753	0.91
89_I	94_K	0.751	0.91
66_M	70_R	0.748	0.91
107_R	114_R	0.747	0.91
66_M	73_S	0.745	0.91
39_K	43_K	0.742	0.91
24_S	58_L	0.738	0.90
30_A	46_G	0.733	0.90
24_S	29_V	0.733	0.90
23_D	26_D	0.725	0.90
43_K	79_T	0.725	0.90
100_K	104_N	0.722	0.89
19_I	63_K	0.722	0.89
27_M	50_E	0.719	0.89
36_I	40_K	0.718	0.89
30_A	41_L	0.711	0.89
102_G	106_A	0.708	0.89
34_S	54_Y	0.704	0.88
47_K	102_G	0.677	0.86
20_F	50_E	0.672	0.86
62_V	74_V	0.663	0.85
108_A	116_M	0.658	0.85
109_K	112_L	0.646	0.84
61_L	68_P	0.646	0.84
41_L	51_L	0.645	0.83
24_S	85_V	0.642	0.83
21_L	86_Y	0.642	0.83
108_A	111_I	0.641	0.83
25_K	80_S	0.639	0.83
51_L	59_E	0.633	0.82
30_A	96_L	0.628	0.82
40_K	62_V	0.622	0.81
37_N	40_K	0.620	0.81
90_D	93_D	0.619	0.81
20_F	26_D	0.597	0.79
24_S	59_E	0.593	0.78
17_R	20_F	0.593	0.78
18_I	29_V	0.587	0.77
27_M	51_L	0.579	0.76
56_D	59_E	0.572	0.76
32_G	99_G	0.567	0.75
44_I	85_V	0.565	0.75
96_L	104_N	0.560	0.74
36_I	101_N	0.559	0.74
99_G	104_N	0.557	0.74
42_K	52_V	0.555	0.73
51_L	93_D	0.550	0.73
109_K	116_M	0.544	0.72
97_A	100_K	0.544	0.72
14_E	48_D	0.543	0.72
44_I	71_V	0.542	0.72
22_V	52_V	0.541	0.71
108_A	114_R	0.536	0.71
81_S	94_K	0.536	0.71
23_D	48_D	0.534	0.70
57_N	110_L	0.528	0.70
104_N	108_A	0.528	0.70
72_R	83_K	0.527	0.69
64_N	69_A	0.527	0.69
56_D	92_Q	0.525	0.69
42_K	50_E	0.524	0.69
43_K	89_I	0.519	0.68
30_A	38_V	0.519	0.68
38_V	93_D	0.518	0.68
63_K	74_V	0.516	0.68
26_D	29_V	0.512	0.67
87_I	93_D	0.511	0.67
98_I	101_N	0.510	0.67
17_R	69_A	0.509	0.67
19_I	38_V	0.505	0.66
67_S	101_N	0.504	0.66
59_E	85_V	0.502	0.66
110_L	115_Y	0.502	0.66
65_L	73_S	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3krmA	3	0.8871	99.7	0.361	Contact Map
2anrA	1	0.9032	99.7	0.374	Contact Map
2jzxA	1	0.9032	99.7	0.376	Contact Map
2jvzA	1	0.8871	99.6	0.382	Contact Map
3n89A	2	0.9516	99.6	0.384	Contact Map
1j4wA	1	0.879	99.6	0.389	Contact Map
2cxcA	1	1	99.6	0.413	Contact Map
2qndA	2	0.8548	99.5	0.429	Contact Map
1tuaA	1	0.9032	99.5	0.458	Contact Map
2e3uA	1	0.8871	99.3	0.497	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.