RL30E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL30E - 50S ribosomal protein L30e

UniProt:	Q980R3	Sequences: MIKVSEQQVSFEGELKSLLKTGKVIFGAKRAIKYIKLSKVKMVIVASTLRGDLKQDIMHYAKLSNIPVYEYKGSGWDLGTLCGKPFMISTISIIDEGDSKILDIIKER	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (99)
Sequences:	410 (214)
Seq/√Len:	21.5

SULSO - RL30E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_V	92_S	5.098	1.00
59_H	63_L	2.485	0.98
11_F	71_Y	2.404	0.97
26_F	88_I	2.042	0.93
53_L	56_D	2.032	0.93
48_T	75_G	1.982	0.92
45_V	57_I	1.978	0.92
28_A	53_L	1.964	0.92
54_K	58_M	1.861	0.89
31_A	92_S	1.817	0.88
61_A	68_V	1.765	0.87
80_T	98_D	1.741	0.86
18_L	91_I	1.718	0.85
47_S	72_K	1.684	0.84
56_D	66_I	1.670	0.83
50_R	75_G	1.626	0.82
19_L	24_V	1.561	0.79
99_S	102_L	1.556	0.79
42_M	81_L	1.553	0.78
31_A	38_S	1.527	0.77
67_P	102_L	1.471	0.75
24_V	84_K	1.454	0.74
15_L	20_K	1.454	0.74
39_K	68_V	1.440	0.73
14_E	100_K	1.433	0.73
78_L	88_I	1.425	0.72
47_S	67_P	1.416	0.72
15_L	19_L	1.371	0.69
21_T	26_F	1.334	0.67
27_G	79_G	1.326	0.66
18_L	82_C	1.319	0.66
48_T	59_H	1.290	0.64
13_G	17_S	1.287	0.64
11_F	32_I	1.246	0.61
7_Q	10_S	1.224	0.60
46_A	91_I	1.170	0.57
65_N	94_I	1.154	0.55
31_A	90_T	1.153	0.55
37_L	46_A	1.152	0.55
60_Y	63_L	1.150	0.55
31_A	43_V	1.131	0.54
10_S	102_L	1.120	0.53
39_K	43_V	1.111	0.53
6_E	65_N	1.090	0.51
93_I	101_I	1.086	0.51
34_Y	59_H	1.079	0.50
67_P	103_D	1.073	0.50
85_P	103_D	1.069	0.50
21_T	60_Y	1.062	0.49
39_K	55_Q	1.061	0.49
25_I	93_I	1.046	0.48
91_I	94_I	1.033	0.47
45_V	65_N	1.029	0.47
13_G	24_V	1.025	0.47
75_G	87_M	1.024	0.47
43_V	77_D	1.004	0.45
32_I	41_K	0.989	0.44
45_V	85_P	0.987	0.44
19_L	31_A	0.975	0.43
77_D	89_S	0.970	0.43
71_Y	100_K	0.962	0.43
39_K	54_K	0.948	0.42
62_K	69_Y	0.947	0.42
16_K	42_M	0.928	0.40
12_E	71_Y	0.927	0.40
66_I	72_K	0.896	0.38
19_L	91_I	0.892	0.38
87_M	95_D	0.890	0.38
34_Y	92_S	0.886	0.38
87_M	100_K	0.882	0.37
29_K	32_I	0.878	0.37
26_F	33_K	0.871	0.37
50_R	98_D	0.845	0.35
47_S	69_Y	0.836	0.35
34_Y	86_F	0.831	0.34
18_L	80_T	0.826	0.34
43_V	64_S	0.819	0.34
18_L	48_T	0.811	0.33
74_S	82_C	0.808	0.33
65_N	100_K	0.805	0.33
41_K	74_S	0.794	0.32
70_E	95_D	0.794	0.32
8_Q	34_Y	0.793	0.32
59_H	75_G	0.793	0.32
10_S	20_K	0.784	0.31
56_D	64_S	0.780	0.31
38_S	48_T	0.767	0.31
74_S	77_D	0.742	0.29
30_R	38_S	0.742	0.29
39_K	80_T	0.737	0.29
83_G	93_I	0.737	0.29
14_E	75_G	0.731	0.28
11_F	26_F	0.730	0.28
15_L	56_D	0.722	0.28
16_K	45_V	0.721	0.28
17_S	59_H	0.718	0.28
54_K	93_I	0.712	0.27
37_L	44_I	0.711	0.27
65_N	71_Y	0.700	0.27
76_W	87_M	0.699	0.27
23_K	58_M	0.686	0.26
79_G	101_I	0.685	0.26
13_G	45_V	0.678	0.26
64_S	80_T	0.676	0.26
98_D	101_I	0.667	0.25
26_F	98_D	0.661	0.25
8_Q	46_A	0.654	0.24
22_G	57_I	0.646	0.24
40_V	96_E	0.646	0.24
25_I	30_R	0.637	0.24
44_I	78_L	0.636	0.24
84_K	88_I	0.634	0.23
42_M	92_S	0.631	0.23
46_A	81_L	0.629	0.23
29_K	95_D	0.621	0.23
47_S	77_D	0.619	0.23
65_N	99_S	0.611	0.22
79_G	84_K	0.611	0.22
54_K	70_E	0.610	0.22
17_S	58_M	0.608	0.22
44_I	93_I	0.602	0.22
39_K	77_D	0.602	0.22
29_K	33_K	0.600	0.22
30_R	52_D	0.598	0.22
25_I	44_I	0.587	0.21
38_S	66_I	0.585	0.21
24_V	102_L	0.581	0.21
6_E	9_V	0.578	0.21
38_S	42_M	0.578	0.21
28_A	89_S	0.572	0.21
74_S	86_F	0.572	0.21
25_I	76_W	0.564	0.20
67_P	94_I	0.558	0.20
34_Y	61_A	0.556	0.20
37_L	89_S	0.552	0.20
28_A	32_I	0.550	0.20
16_K	103_D	0.543	0.19
15_L	100_K	0.539	0.19
37_L	77_D	0.536	0.19
25_I	51_G	0.527	0.19
68_V	100_K	0.518	0.18
29_K	49_L	0.517	0.18
15_L	98_D	0.516	0.18
22_G	27_G	0.515	0.18
88_I	91_I	0.509	0.18
69_Y	75_G	0.505	0.18
40_V	82_C	0.503	0.18
26_F	55_Q	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1w41A	1	0.9167	99.9	0.458	Contact Map
3cpqA	2	0.9259	99.9	0.46	Contact Map
1vx76	1	0.9074	99.9	0.465	Contact Map
3j61c	1	1	99.9	0.468	Contact Map
3j21Z	1	0.9167	99.9	0.468	Contact Map
3zf7g	1	0.8889	99.9	0.476	Contact Map
3u5ec	1	0.8981	99.9	0.484	Contact Map
3vi6A	3	0.8981	99.9	0.486	Contact Map
4a18G	1	0.8889	99.9	0.487	Contact Map
4nutA	1	0.9722	99.8	0.541	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.