UPP - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UPP - Uracil phosphoribosyltransferase

UniProt:	Q980Q4	Sequences: MPLYVIDKPITLHILTQLRDKYTDQINFRKNLVRLGRILGYEISNTLDYEIVEVETPLGVKTKGVDITDLNNIVIINILRAAVPLVEGLLKAFPKARQGVIGASRVEVDGKEVPKDMDVYIYYKKIPDIRAKVDNVIIADPMIATASTMLKVLEEVVKANPKRIYIVSIISSEYGVNKILSKYPFIYLFTVAIDPELNNKGYILPGLGDAGDRAFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	216 (202)
Sequences:	3062 (1572)
Seq/√Len:	110.6

ECOLI - UPP
BACSU - UPP
HALSA - UPP
SULSO - UPP

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_K	55_E	4.041	1.00
117_M	201_G	3.958	1.00
177_N	181_S	3.783	1.00
171_S	190_T	3.418	1.00
51_I	63_K	3.033	1.00
16_T	64_G	2.955	1.00
149_M	166_I	2.773	1.00
33_V	91_K	2.767	1.00
176_V	193_I	2.715	1.00
150_L	182_K	2.506	1.00
150_L	178_K	2.486	1.00
59_G	195_P	2.460	1.00
153_L	179_I	2.445	1.00
53_E	60_V	2.422	1.00
26_I	30_K	2.403	1.00
53_E	63_K	2.258	1.00
51_I	65_V	2.189	1.00
50_E	66_D	2.161	1.00
75_I	139_A	2.145	1.00
154_E	158_K	2.143	1.00
173_E	177_N	2.142	1.00
178_K	182_K	2.092	1.00
40_G	89_L	2.061	1.00
104_S	120_Y	1.949	1.00
52_V	66_D	1.914	1.00
89_L	167_V	1.887	1.00
24_D	27_N	1.838	1.00
157_V	183_Y	1.814	1.00
58_L	204_L	1.808	1.00
18_L	32_L	1.794	1.00
12_L	65_V	1.794	1.00
166_I	179_I	1.767	1.00
154_E	182_K	1.744	1.00
33_V	87_E	1.738	1.00
106_V	120_Y	1.735	1.00
59_G	204_L	1.699	1.00
198_N	204_L	1.684	1.00
50_E	68_T	1.656	1.00
135_N	163_R	1.655	1.00
11_T	35_L	1.654	1.00
55_E	60_V	1.604	1.00
59_G	62_T	1.570	1.00
177_N	180_L	1.560	1.00
173_E	195_P	1.549	1.00
42_E	45_N	1.539	1.00
46_T	165_Y	1.538	1.00
76_I	99_G	1.537	1.00
176_V	188_L	1.534	1.00
119_V	147_S	1.500	1.00
77_N	83_V	1.476	1.00
36_G	85_L	1.462	1.00
156_V	161_P	1.460	1.00
14_I	34_R	1.440	1.00
54_V	62_T	1.401	1.00
151_K	154_E	1.395	1.00
15_L	191_V	1.393	1.00
37_R	91_K	1.389	1.00
90_L	98_Q	1.379	1.00
5_V	193_I	1.352	1.00
43_I	167_V	1.335	1.00
195_P	204_L	1.319	1.00
150_L	154_E	1.284	0.99
32_L	169_I	1.283	0.99
107_E	115_K	1.282	0.99
168_S	190_T	1.269	0.99
75_I	89_L	1.262	0.99
155_E	159_A	1.246	0.99
153_L	164_I	1.244	0.99
47_L	73_I	1.239	0.99
157_V	185_F	1.236	0.99
165_Y	187_Y	1.226	0.99
44_S	93_F	1.222	0.99
196_E	204_L	1.210	0.99
72_N	134_D	1.195	0.99
99_G	126_I	1.194	0.99
107_E	200_K	1.172	0.99
136_V	161_P	1.163	0.99
29_R	90_L	1.161	0.99
39_L	43_I	1.160	0.99
124_K	159_A	1.157	0.99
154_E	183_Y	1.145	0.99
124_K	155_E	1.142	0.99
23_T	213_R	1.141	0.99
18_L	31_N	1.138	0.99
39_L	167_V	1.132	0.98
101_I	152_V	1.130	0.98
155_E	158_K	1.109	0.98
179_I	188_L	1.103	0.98
99_G	127_P	1.089	0.98
103_A	148_T	1.078	0.98
74_V	130_R	1.073	0.98
118_D	178_K	1.050	0.97
6_I	11_T	1.050	0.97
48_D	68_T	1.043	0.97
35_L	191_V	1.041	0.97
162_K	185_F	1.039	0.97
73_I	134_D	1.028	0.97
194_D	203_I	1.024	0.97
106_V	115_K	1.009	0.97
174_Y	196_E	1.007	0.97
74_V	136_V	1.006	0.97
44_S	47_L	0.996	0.97
76_I	126_I	0.994	0.96
27_N	30_K	0.989	0.96
18_L	35_L	0.977	0.96
17_Q	66_D	0.964	0.96
40_G	88_G	0.963	0.96
173_E	196_E	0.961	0.96
129_I	134_D	0.953	0.96
121_I	155_E	0.942	0.95
138_I	156_V	0.937	0.95
40_G	75_I	0.937	0.95
20_D	54_V	0.928	0.95
11_T	38_I	0.928	0.95
135_N	165_Y	0.926	0.95
49_Y	65_V	0.924	0.95
196_E	199_N	0.922	0.95
7_D	12_L	0.918	0.95
83_V	100_V	0.906	0.94
75_I	93_F	0.886	0.93
130_R	161_P	0.873	0.93
14_I	31_N	0.869	0.93
165_Y	189_F	0.868	0.93
37_R	92_A	0.866	0.93
163_R	187_Y	0.859	0.92
151_K	155_E	0.859	0.92
60_V	63_K	0.858	0.92
84_P	214_A	0.854	0.92
16_T	66_D	0.853	0.92
52_V	64_G	0.852	0.92
4_Y	189_F	0.837	0.91
43_I	137_I	0.822	0.91
40_G	92_A	0.821	0.91
15_L	170_I	0.819	0.90
130_R	136_V	0.819	0.90
137_I	165_Y	0.810	0.90
86_V	100_V	0.808	0.90
153_L	186_I	0.807	0.90
116_D	119_V	0.803	0.90
174_Y	177_N	0.803	0.90
17_Q	27_N	0.802	0.89
180_L	187_Y	0.793	0.89
150_L	179_I	0.789	0.89
138_I	153_L	0.776	0.88
33_V	37_R	0.775	0.88
137_I	167_V	0.761	0.87
6_I	39_L	0.759	0.87
178_K	181_S	0.753	0.86
7_D	45_N	0.750	0.86
142_M	203_I	0.749	0.86
190_T	193_I	0.747	0.86
86_V	98_Q	0.747	0.86
175_G	197_L	0.745	0.86
19_R	194_D	0.741	0.85
40_G	43_I	0.741	0.85
138_I	152_V	0.739	0.85
170_I	192_A	0.734	0.85
15_L	192_A	0.728	0.84
81_A	142_M	0.727	0.84
16_T	54_V	0.726	0.84
74_V	126_I	0.725	0.84
54_V	60_V	0.725	0.84
73_I	135_N	0.725	0.84
23_T	27_N	0.723	0.84
179_I	186_I	0.722	0.84
104_S	123_Y	0.722	0.84
74_V	99_G	0.721	0.84
17_Q	23_T	0.719	0.84
102_G	122_Y	0.705	0.83
32_L	35_L	0.705	0.83
105_R	211_G	0.703	0.82
77_N	139_A	0.703	0.82
105_R	142_M	0.701	0.82
75_I	86_V	0.701	0.82
106_V	118_D	0.699	0.82
33_V	36_G	0.695	0.82
135_N	162_K	0.694	0.82
126_I	159_A	0.691	0.81
38_I	41_Y	0.691	0.81
180_L	188_L	0.689	0.81
97_R	134_D	0.688	0.81
36_G	88_G	0.686	0.81
129_I	132_K	0.684	0.81
194_D	205_P	0.680	0.80
19_R	205_P	0.678	0.80
168_S	171_S	0.678	0.80
105_R	209_D	0.675	0.80
17_Q	31_N	0.673	0.80
4_Y	187_Y	0.669	0.79
121_I	159_A	0.669	0.79
142_M	207_L	0.664	0.79
142_M	148_T	0.661	0.78
83_V	86_V	0.658	0.78
147_S	178_K	0.656	0.78
34_R	41_Y	0.655	0.78
44_S	67_I	0.653	0.77
10_I	38_I	0.644	0.76
32_L	210_A	0.643	0.76
32_L	36_G	0.641	0.76
73_I	93_F	0.641	0.76
136_V	156_V	0.640	0.76
138_I	179_I	0.638	0.76
183_Y	186_I	0.637	0.76
59_G	196_E	0.636	0.76
103_A	151_K	0.629	0.75
202_Y	210_A	0.629	0.75
116_D	152_V	0.623	0.74
154_E	157_V	0.617	0.73
54_V	64_G	0.615	0.73
105_R	144_A	0.615	0.73
38_I	92_A	0.614	0.73
32_L	214_A	0.612	0.73
86_V	139_A	0.611	0.73
20_D	52_V	0.610	0.73
142_M	202_Y	0.609	0.72
107_E	147_S	0.609	0.72
87_E	91_K	0.606	0.72
153_L	157_V	0.602	0.72
6_I	190_T	0.601	0.71
174_Y	195_P	0.593	0.70
103_A	155_E	0.591	0.70
23_T	57_P	0.588	0.70
176_V	180_L	0.588	0.70
119_V	151_K	0.588	0.70
203_I	209_D	0.587	0.70
176_V	190_T	0.587	0.70
105_R	141_P	0.587	0.70
25_Q	29_R	0.585	0.69
48_D	71_N	0.582	0.69
105_R	148_T	0.581	0.69
203_I	207_L	0.578	0.68
106_V	116_D	0.577	0.68
56_T	62_T	0.576	0.68
22_Y	55_E	0.575	0.68
28_F	81_A	0.573	0.68
164_I	186_I	0.572	0.68
24_D	95_K	0.572	0.68
116_D	147_S	0.571	0.68
32_L	85_L	0.571	0.68
81_A	202_Y	0.571	0.68
31_N	34_R	0.570	0.67
92_A	95_K	0.569	0.67
10_I	92_A	0.567	0.67
12_L	192_A	0.567	0.67
81_A	210_A	0.566	0.67
157_V	186_I	0.565	0.67
168_S	176_V	0.564	0.67
187_Y	190_T	0.564	0.67
27_N	165_Y	0.563	0.66
101_I	124_K	0.562	0.66
18_L	43_I	0.562	0.66
11_T	191_V	0.560	0.66
156_V	160_N	0.559	0.66
57_P	213_R	0.557	0.66
30_K	91_K	0.557	0.66
16_T	20_D	0.557	0.66
24_D	97_R	0.555	0.65
19_R	206_G	0.555	0.65
128_D	131_A	0.554	0.65
117_M	200_K	0.550	0.65
85_L	169_I	0.547	0.64
126_I	155_E	0.545	0.64
183_Y	188_L	0.545	0.64
150_L	183_Y	0.543	0.64
149_M	188_L	0.543	0.64
205_P	208_G	0.543	0.64
130_R	134_D	0.542	0.64
14_I	38_I	0.541	0.63
46_T	187_Y	0.540	0.63
81_A	211_G	0.539	0.63
121_I	151_K	0.539	0.63
81_A	203_I	0.539	0.63
194_D	206_G	0.539	0.63
12_L	49_Y	0.539	0.63
86_V	89_L	0.535	0.63
33_V	214_A	0.534	0.62
119_V	148_T	0.533	0.62
37_R	40_G	0.533	0.62
138_I	164_I	0.531	0.62
93_F	96_A	0.526	0.61
169_I	191_V	0.526	0.61
103_A	121_I	0.525	0.61
40_G	167_V	0.523	0.61
13_H	34_R	0.523	0.61
13_H	17_Q	0.520	0.60
4_Y	7_D	0.518	0.60
148_T	151_K	0.518	0.60
45_N	92_A	0.518	0.60
33_V	40_G	0.518	0.60
148_T	168_S	0.516	0.60
21_K	60_V	0.516	0.60
81_A	105_R	0.514	0.60
67_I	93_F	0.513	0.59
118_D	151_K	0.512	0.59
43_I	136_V	0.510	0.59
58_L	198_N	0.510	0.59
78_I	169_I	0.508	0.59
26_I	85_L	0.505	0.58
103_A	119_V	0.505	0.58
46_T	189_F	0.505	0.58
143_I	146_A	0.502	0.58
82_A	122_Y	0.502	0.58
202_Y	209_D	0.500	0.57

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xttA	3	0.963	100	0.227	Contact Map
1bd3D	3	0.9537	100	0.283	Contact Map
3dmpA	4	0.9444	100	0.284	Contact Map
2ehjA	3	0.9537	100	0.289	Contact Map
1o5oA	3	0.9537	100	0.291	Contact Map
1v9sA	3	0.9537	100	0.295	Contact Map
2e55A	3	0.9444	100	0.313	Contact Map
1i5eA	2	0.9537	100	0.367	Contact Map
3s5jB	2	0.875	99.8	0.742	Contact Map
1qb7A	2	0.912	99.7	0.772	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.