Q980P0 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980P0 - HIT-like protein, hypothetical (Hit)

UniProt:	Q980P0	Sequences: MDILWAPWRAKYISETSKVKQDECLFCRVIKEENDEQNYIVYRGKHAFIILNAFPYNTAHVMVVPYRHVPSVELLSNDEALDIFTLSTIAIRAIRDIYAPDGFNIGVNIGRVAGAGIESHIHVHIVPRWNGDSNFMPVIFNTKVMPETLSDTFKKLNTKVNEIMKKPSRSE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (137)
Sequences:	3282 (2255)
Seq/√Len:	192.6

ECOLI - HINT
BACSU - HIT
HALSA - Q9HP05 Q9HNA0
SULSO - Q980P0 YHIT

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
24_C	27_C	3.807	1.00
27_C	68_H	3.278	1.00
24_C	68_H	3.170	1.00
67_R	79_E	2.973	1.00
47_A	86_L	2.958	1.00
46_H	82_D	2.861	1.00
43_R	66_Y	2.842	1.00
77_N	88_T	2.648	1.00
44_G	82_D	2.556	1.00
76_S	79_E	2.509	1.00
87_S	123_V	2.430	1.00
39_Y	150_S	2.284	1.00
75_L	121_I	2.074	1.00
77_N	85_T	2.002	1.00
153_F	157_N	1.940	1.00
81_L	85_T	1.807	1.00
61_V	90_A	1.750	1.00
83_I	123_V	1.749	1.00
67_R	76_S	1.730	1.00
28_R	35_D	1.727	1.00
50_I	64_V	1.723	1.00
34_N	40_I	1.633	1.00
40_I	48_F	1.608	1.00
41_V	61_V	1.603	1.00
42_Y	86_L	1.568	1.00
96_D	159_K	1.564	1.00
144_V	149_L	1.555	1.00
63_V	87_S	1.534	1.00
69_V	76_S	1.509	1.00
73_E	95_R	1.496	1.00
38_N	48_F	1.475	1.00
47_A	82_D	1.469	1.00
58_T	148_T	1.453	1.00
88_T	92_R	1.444	1.00
71_S	74_L	1.388	1.00
29_V	38_N	1.383	1.00
34_N	37_Q	1.367	1.00
80_A	84_F	1.358	1.00
154_K	158_T	1.351	1.00
93_A	97_I	1.348	1.00
151_D	155_K	1.346	1.00
80_A	88_T	1.336	1.00
97_I	159_K	1.314	1.00
95_R	103_F	1.286	1.00
104_N	128_R	1.282	1.00
150_S	154_K	1.278	1.00
48_F	66_Y	1.269	1.00
69_V	75_L	1.252	1.00
40_I	43_R	1.240	1.00
39_Y	146_P	1.237	1.00
63_V	125_I	1.212	1.00
107_V	123_V	1.204	1.00
57_N	129_W	1.177	1.00
26_F	117_I	1.168	1.00
36_E	154_K	1.165	1.00
49_I	61_V	1.155	1.00
84_F	123_V	1.154	1.00
104_N	108_N	1.139	1.00
136_M	139_I	1.085	1.00
83_I	121_I	1.062	1.00
71_S	95_R	1.056	1.00
72_V	84_F	1.054	1.00
145_M	148_T	1.052	1.00
61_V	94_I	1.051	1.00
98_Y	152_T	1.051	1.00
95_R	110_G	1.048	1.00
69_V	79_E	1.036	1.00
94_I	156_L	1.024	1.00
147_E	155_K	1.019	1.00
87_S	105_I	1.015	1.00
112_V	130_N	0.997	1.00
70_P	110_G	0.991	0.99
70_P	74_L	0.982	0.99
49_I	90_A	0.980	0.99
110_G	113_A	0.963	0.99
51_L	61_V	0.949	0.99
49_I	86_L	0.944	0.99
149_L	153_F	0.939	0.99
101_D	130_N	0.937	0.99
104_N	113_A	0.907	0.99
97_I	156_L	0.895	0.99
77_N	81_L	0.891	0.99
70_P	118_E	0.882	0.99
44_G	86_L	0.879	0.99
75_L	80_A	0.872	0.99
151_D	154_K	0.871	0.99
94_I	125_I	0.868	0.99
30_I	64_V	0.867	0.99
39_Y	51_L	0.855	0.98
101_D	112_V	0.855	0.98
148_T	151_D	0.854	0.98
58_T	155_K	0.848	0.98
105_I	123_V	0.841	0.98
82_D	86_L	0.841	0.98
48_F	64_V	0.833	0.98
71_S	110_G	0.821	0.98
69_V	121_I	0.816	0.98
71_S	118_E	0.814	0.98
27_C	33_E	0.806	0.98
91_I	95_R	0.802	0.98
111_R	118_E	0.799	0.98
69_V	74_L	0.786	0.97
39_Y	149_L	0.785	0.97
90_A	160_V	0.781	0.97
46_H	79_E	0.766	0.97
25_L	117_I	0.763	0.97
47_A	83_I	0.759	0.97
128_R	132_D	0.759	0.97
91_I	105_I	0.754	0.97
25_L	28_R	0.754	0.97
49_I	63_V	0.749	0.97
23_E	28_R	0.747	0.96
107_V	121_I	0.744	0.96
144_V	152_T	0.741	0.96
93_A	156_L	0.734	0.96
134_N	139_I	0.728	0.96
102_G	112_V	0.715	0.95
51_L	108_N	0.709	0.95
146_P	150_S	0.707	0.95
100_P	129_W	0.698	0.95
135_F	138_V	0.694	0.95
103_F	125_I	0.690	0.95
115_A	118_E	0.689	0.94
39_Y	153_F	0.681	0.94
72_V	105_I	0.680	0.94
73_E	92_R	0.680	0.94
73_E	103_F	0.680	0.94
29_V	50_I	0.677	0.94
114_G	137_P	0.674	0.94
29_V	53_A	0.674	0.94
57_N	126_V	0.670	0.94
51_L	149_L	0.669	0.94
28_R	36_E	0.668	0.94
93_A	160_V	0.666	0.93
144_V	148_T	0.665	0.93
86_L	89_I	0.660	0.93
133_S	136_M	0.659	0.93
30_I	48_F	0.659	0.93
73_E	91_I	0.658	0.93
140_F	143_K	0.656	0.93
91_I	103_F	0.654	0.93
40_I	66_Y	0.650	0.93
85_T	88_T	0.649	0.93
29_V	64_V	0.648	0.92
42_Y	89_I	0.645	0.92
85_T	89_I	0.634	0.92
56_Y	136_M	0.624	0.91
147_E	150_S	0.620	0.91
81_L	84_F	0.619	0.91
42_Y	160_V	0.618	0.91
36_E	53_A	0.615	0.90
75_L	79_E	0.615	0.90
84_F	87_S	0.611	0.90
62_M	136_M	0.604	0.90
26_F	64_V	0.600	0.89
153_F	156_L	0.600	0.89
41_V	157_N	0.595	0.89
146_P	149_L	0.593	0.89
134_N	137_P	0.592	0.89
35_D	43_R	0.591	0.89
39_Y	53_A	0.590	0.89
111_R	130_N	0.587	0.88
54_F	144_V	0.587	0.88
21_Q	28_R	0.579	0.88
60_H	124_H	0.578	0.88
41_V	153_F	0.576	0.87
80_A	85_T	0.575	0.87
30_I	66_Y	0.573	0.87
113_A	126_V	0.572	0.87
103_F	107_V	0.562	0.86
148_T	152_T	0.562	0.86
34_N	38_N	0.561	0.86
84_F	88_T	0.558	0.86
58_T	152_T	0.558	0.86
104_N	126_V	0.553	0.85
128_R	131_G	0.552	0.85
56_Y	116_G	0.551	0.85
56_Y	106_G	0.549	0.85
132_D	137_P	0.547	0.85
42_Y	49_I	0.547	0.85
133_S	137_P	0.545	0.84
78_D	81_L	0.544	0.84
102_G	115_A	0.543	0.84
152_T	155_K	0.539	0.84
25_L	29_V	0.537	0.83
154_K	157_N	0.537	0.83
97_I	155_K	0.537	0.83
100_P	103_F	0.533	0.83
147_E	151_D	0.533	0.83
46_H	78_D	0.531	0.83
70_P	73_E	0.531	0.83
109_I	115_A	0.530	0.83
144_V	147_E	0.526	0.82
97_I	100_P	0.525	0.82
55_P	65_P	0.523	0.82
130_N	133_S	0.520	0.81
141_N	144_V	0.518	0.81
36_E	40_I	0.517	0.81
106_G	126_V	0.510	0.80
150_S	157_N	0.506	0.80
90_A	93_A	0.505	0.80
75_L	83_I	0.505	0.80
95_R	100_P	0.504	0.79
83_I	86_L	0.501	0.79
94_I	98_Y	0.500	0.79
71_S	109_I	0.500	0.79

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3anoA	4	0.9591	100	0.221	Contact Map
3l7xA	2	0.9064	100	0.299	Contact Map
3ksvA	2	0.8246	100	0.319	Contact Map
3lb5A	2	0.8012	100	0.342	Contact Map
3imiA	2	0.8246	100	0.353	Contact Map
2eo4A	2	0.848	100	0.364	Contact Map
1y23A	2	0.8129	100	0.368	Contact Map
3o0mA	2	0.807	100	0.369	Contact Map
1emsA	3	0.848	100	0.387	Contact Map
3r6fA	2	0.7602	100	0.393	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.