GGGPS - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GGGPS - Geranylgeranylglyceryl phosphate synthase

UniProt:	Q980N1	Sequences: MRILKKKMKLKGKVKKYLIDKLNDNEKLHFSLIDPFKINSSDELKYITKNLYNAGTDAFLIGGTLGVSKDKLDFVISLLDDYEIPKIIFPSNINLLSEKADALLFMSLLNSDDIYYIIGAQIVAAPIIKMLQMEVIPTAYVIVGHGGTAAHIGKARVIPYDNFELATAYTLAAEYLGMSFVYLEAGSGAPEPIRPEMISFIKNASSIPLIVGGGIRSVEVALKLVEAGADIIVTGNIIESDVNKAIKIIRGIKNK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	255 (217)
Sequences:	639 (487)
Seq/√Len:	33.1

BACSU - PCRB
HALSA - GGGPS Q9HNW3
SULSO - GGGPS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
142_I	149_A	8.358	1.00
216_R	220_V	4.826	1.00
61_I	79_L	4.297	1.00
205_S	209_L	4.152	1.00
217_S	220_V	3.938	1.00
141_V	181_V	3.598	1.00
113_D	154_K	3.447	1.00
114_I	117_I	3.104	1.00
107_S	178_M	2.838	1.00
30_F	233_V	2.815	1.00
208_P	231_I	2.720	1.00
216_R	240_S	2.346	0.99
33_I	75_V	2.336	0.99
115_Y	120_A	2.297	0.99
90_P	105_F	2.280	0.99
96_L	103_L	2.239	0.99
60_L	104_L	2.205	0.99
150_A	157_V	2.201	0.99
126_P	164_E	2.127	0.99
65_L	148_T	2.126	0.99
166_A	197_M	2.110	0.99
61_I	76_I	2.000	0.98
29_H	56_T	1.978	0.98
173_A	207_I	1.948	0.97
36_F	65_L	1.893	0.97
170_T	174_E	1.887	0.97
69_K	97_S	1.887	0.97
199_S	226_E	1.885	0.97
180_F	210_I	1.838	0.96
144_G	160_Y	1.816	0.96
195_P	224_L	1.763	0.95
36_F	66_G	1.745	0.95
218_V	222_L	1.744	0.95
221_A	232_I	1.735	0.95
241_D	244_K	1.698	0.94
61_I	86_K	1.678	0.94
171_L	175_Y	1.646	0.93
190_P	223_K	1.626	0.93
72_L	88_I	1.622	0.93
199_S	203_N	1.564	0.91
139_A	178_M	1.551	0.91
190_P	224_L	1.546	0.91
73_D	97_S	1.543	0.91
107_S	176_L	1.484	0.89
104_L	138_T	1.482	0.89
44_L	78_L	1.479	0.89
73_D	99_K	1.470	0.89
114_I	119_G	1.466	0.88
51_L	59_F	1.463	0.88
210_I	233_V	1.430	0.87
43_E	242_V	1.414	0.87
118_I	176_L	1.403	0.86
92_N	95_L	1.399	0.86
196_E	199_S	1.397	0.86
145_H	160_Y	1.354	0.84
77_S	99_K	1.336	0.83
244_K	247_K	1.331	0.83
30_F	60_L	1.327	0.83
40_S	43_E	1.327	0.83
217_S	223_K	1.311	0.82
198_I	224_L	1.308	0.82
87_I	102_A	1.285	0.81
88_I	201_I	1.276	0.80
222_L	226_E	1.256	0.79
30_F	58_A	1.244	0.79
215_I	221_A	1.234	0.78
33_I	54_A	1.229	0.78
33_I	39_N	1.219	0.77
159_P	162_N	1.216	0.77
29_H	234_T	1.212	0.77
64_T	224_L	1.205	0.76
157_V	160_Y	1.196	0.76
102_A	136_I	1.189	0.75
106_M	153_G	1.187	0.75
170_T	204_A	1.157	0.73
79_L	82_Y	1.147	0.73
142_I	155_A	1.138	0.72
237_I	244_K	1.113	0.70
27_K	230_D	1.105	0.70
70_D	74_F	1.102	0.70
136_I	180_F	1.091	0.69
123_V	161_D	1.089	0.69
54_A	75_V	1.084	0.68
52_Y	84_I	1.081	0.68
33_I	145_H	1.079	0.68
173_A	181_V	1.066	0.67
171_L	206_S	1.061	0.67
51_L	54_A	1.055	0.66
125_A	173_A	1.055	0.66
221_A	225_V	1.038	0.65
200_F	203_N	1.036	0.65
136_I	217_S	1.034	0.65
147_G	155_A	1.027	0.64
242_V	246_I	1.022	0.64
70_D	199_S	1.011	0.63
79_L	86_K	1.010	0.63
128_I	135_V	1.006	0.62
31_S	238_I	1.003	0.62
169_Y	173_A	1.000	0.62
190_P	195_P	0.999	0.62
185_A	191_E	0.990	0.61
118_I	125_A	0.988	0.61
111_S	153_G	0.982	0.60
36_F	148_T	0.975	0.60
162_N	166_A	0.973	0.60
121_Q	171_L	0.961	0.59
31_S	56_T	0.958	0.59
118_I	122_I	0.957	0.58
110_N	142_I	0.956	0.58
121_Q	176_L	0.949	0.58
71_K	74_F	0.936	0.57
167_T	200_F	0.934	0.57
236_N	239_E	0.928	0.56
109_L	139_A	0.927	0.56
126_P	168_A	0.927	0.56
182_Y	212_G	0.926	0.56
137_P	172_A	0.918	0.55
109_L	178_M	0.916	0.55
78_L	82_Y	0.906	0.54
26_E	206_S	0.905	0.54
66_G	71_K	0.892	0.53
64_T	117_I	0.884	0.52
75_V	84_I	0.882	0.52
89_F	108_L	0.877	0.52
150_A	155_A	0.871	0.51
108_L	153_G	0.869	0.51
139_A	181_V	0.868	0.51
217_S	232_I	0.866	0.51
40_S	44_L	0.865	0.51
163_F	167_T	0.860	0.50
142_I	147_G	0.857	0.50
183_L	211_V	0.850	0.50
151_H	159_P	0.849	0.50
37_K	148_T	0.846	0.49
127_I	181_V	0.843	0.49
95_L	111_S	0.835	0.48
76_I	97_S	0.834	0.48
39_N	78_L	0.829	0.48
56_T	184_E	0.824	0.47
114_I	157_V	0.820	0.47
125_A	175_Y	0.810	0.46
84_I	136_I	0.809	0.46
53_N	243_N	0.807	0.46
172_A	181_V	0.805	0.46
116_Y	133_M	0.805	0.46
182_Y	188_G	0.801	0.46
160_Y	194_R	0.801	0.46
149_A	227_A	0.796	0.45
31_S	245_A	0.788	0.44
195_P	223_K	0.787	0.44
105_F	121_Q	0.786	0.44
29_H	110_N	0.786	0.44
117_I	146_G	0.778	0.44
155_A	225_V	0.778	0.44
118_I	137_P	0.775	0.43
31_S	75_V	0.774	0.43
136_I	207_I	0.773	0.43
61_I	84_I	0.773	0.43
95_L	142_I	0.764	0.42
112_D	154_K	0.757	0.42
218_V	244_K	0.756	0.42
146_G	189_A	0.746	0.41
144_G	149_A	0.745	0.41
141_V	201_I	0.742	0.41
188_G	212_G	0.738	0.40
156_R	159_P	0.734	0.40
164_E	179_S	0.733	0.40
58_A	184_E	0.731	0.40
109_L	176_L	0.729	0.40
121_Q	137_P	0.728	0.40
122_I	189_A	0.722	0.39
123_V	159_P	0.720	0.39
82_Y	86_K	0.720	0.39
70_D	77_S	0.720	0.39
121_Q	166_A	0.720	0.39
56_T	234_T	0.717	0.39
107_S	197_M	0.708	0.38
60_L	131_L	0.707	0.38
110_N	169_Y	0.707	0.38
60_L	138_T	0.704	0.38
56_T	84_I	0.696	0.37
177_G	227_A	0.694	0.37
91_S	149_A	0.694	0.37
197_M	227_A	0.694	0.37
159_P	189_A	0.693	0.37
166_A	201_I	0.693	0.37
174_E	206_S	0.691	0.37
131_L	135_V	0.690	0.37
107_S	117_I	0.686	0.36
174_E	230_D	0.683	0.36
89_F	211_V	0.680	0.36
96_L	128_I	0.677	0.36
205_S	208_P	0.676	0.36
28_L	67_V	0.674	0.35
125_A	231_I	0.671	0.35
67_V	204_A	0.671	0.35
129_K	174_E	0.669	0.35
133_M	172_A	0.666	0.35
162_N	197_M	0.665	0.35
185_A	211_V	0.662	0.34
72_L	130_M	0.661	0.34
111_S	155_A	0.660	0.34
72_L	147_G	0.660	0.34
139_A	230_D	0.659	0.34
117_I	121_Q	0.658	0.34
181_V	207_I	0.655	0.34
117_I	122_I	0.655	0.34
64_T	136_I	0.654	0.34
76_I	208_P	0.654	0.34
81_D	243_N	0.651	0.34
93_I	120_A	0.647	0.33
50_N	96_L	0.647	0.33
104_L	107_S	0.646	0.33
29_H	55_G	0.642	0.33
177_G	216_R	0.641	0.33
162_N	200_F	0.641	0.33
151_H	154_K	0.639	0.33
124_A	181_V	0.637	0.33
100_A	103_L	0.636	0.33
123_V	126_P	0.635	0.32
68_S	191_E	0.634	0.32
113_D	117_I	0.633	0.32
36_F	133_M	0.632	0.32
93_I	124_A	0.632	0.32
110_N	155_A	0.631	0.32
241_D	245_A	0.629	0.32
26_E	199_S	0.626	0.32
107_S	114_I	0.625	0.32
154_K	197_M	0.625	0.32
90_P	146_G	0.623	0.32
101_D	202_K	0.622	0.32
59_F	103_L	0.616	0.31
183_L	197_M	0.615	0.31
202_K	217_S	0.613	0.31
149_A	226_E	0.611	0.31
52_Y	82_Y	0.610	0.31
125_A	133_M	0.608	0.31
56_T	249_I	0.608	0.31
102_A	216_R	0.606	0.30
220_V	223_K	0.605	0.30
52_Y	81_D	0.604	0.30
69_K	83_E	0.603	0.30
66_G	72_L	0.599	0.30
114_I	118_I	0.593	0.29
53_N	77_S	0.592	0.29
110_N	150_A	0.589	0.29
111_S	114_I	0.584	0.29
40_S	230_D	0.583	0.29
137_P	175_Y	0.581	0.29
43_E	115_Y	0.579	0.29
143_V	197_M	0.578	0.28
106_M	110_N	0.577	0.28
54_A	179_S	0.576	0.28
146_G	233_V	0.575	0.28
33_I	76_I	0.574	0.28
159_P	163_F	0.573	0.28
197_M	200_F	0.573	0.28
142_I	196_E	0.570	0.28
44_L	149_A	0.569	0.28
153_G	169_Y	0.568	0.28
36_F	125_A	0.567	0.28
180_F	238_I	0.566	0.28
64_T	71_K	0.566	0.28
96_L	130_M	0.566	0.28
61_I	244_K	0.565	0.28
240_S	243_N	0.564	0.27
76_I	86_K	0.563	0.27
42_D	131_L	0.563	0.27
110_N	145_H	0.562	0.27
166_A	204_A	0.561	0.27
162_N	165_L	0.558	0.27
177_G	240_S	0.558	0.27
72_L	85_P	0.556	0.27
33_I	80_D	0.553	0.27
185_A	189_A	0.553	0.27
134_E	183_L	0.552	0.27
154_K	161_D	0.552	0.27
132_Q	175_Y	0.549	0.27
33_I	97_S	0.549	0.27
128_I	177_G	0.549	0.27
203_N	206_S	0.549	0.27
133_M	137_P	0.549	0.27
142_I	153_G	0.548	0.26
198_I	230_D	0.547	0.26
73_D	80_D	0.546	0.26
122_I	173_A	0.545	0.26
32_L	89_F	0.545	0.26
140_Y	213_G	0.544	0.26
124_A	144_G	0.541	0.26
111_S	173_A	0.538	0.26
29_H	221_A	0.538	0.26
88_I	100_A	0.537	0.26
110_N	153_G	0.536	0.26
96_L	247_K	0.535	0.26
58_A	87_I	0.534	0.26
187_S	212_G	0.533	0.25
212_G	235_G	0.533	0.25
76_I	79_L	0.533	0.25
42_D	67_V	0.533	0.25
90_P	125_A	0.532	0.25
150_A	160_Y	0.531	0.25
184_E	212_G	0.529	0.25
89_F	106_M	0.526	0.25
114_I	137_P	0.525	0.25
112_D	237_I	0.524	0.25
199_S	250_R	0.523	0.25
111_S	117_I	0.523	0.25
166_A	200_F	0.522	0.25
121_Q	168_A	0.521	0.25
55_G	249_I	0.519	0.25
151_H	162_N	0.518	0.25
52_Y	79_L	0.517	0.24
60_L	237_I	0.515	0.24
134_E	243_N	0.515	0.24
61_I	199_S	0.513	0.24
173_A	231_I	0.511	0.24
107_S	146_G	0.510	0.24
58_A	221_A	0.508	0.24
121_Q	133_M	0.508	0.24
102_A	208_P	0.506	0.24
92_N	120_A	0.505	0.24
36_F	85_P	0.502	0.24
53_N	83_E	0.502	0.24
79_L	236_N	0.502	0.24
69_K	197_M	0.501	0.24
143_V	167_T	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2f6uA	2	0.851	100	0.636	Contact Map
3vzxA	2	0.8706	100	0.646	Contact Map
4mm1A	3	0.9373	100	0.65	Contact Map
3vk5A	2	0.902	100	0.657	Contact Map
3w01A	2	0.8902	100	0.659	Contact Map
4jejA	2	0.9333	100	0.688	Contact Map
4nafA	2	0.8627	100	0.708	Contact Map
3ktsA	1	0.7255	100	0.716	Contact Map
3thaA	2	0.8039	99.7	0.817	Contact Map
1ujpA	1	0.7686	99.7	0.82	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0079 seconds.