TFE - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TFE - Transcription factor E

UniProt:	Q980M5	Sequences: MVNAEDLFINLAKSLLGDDVIDVLRILLDKGTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTRDKDSGWFIYYWKPNIDQINEILLNRKRLILDKLKTRLEYEKNNTFFICPQDNSRYSFEEAFENEFKCLKCGSQLTYYDTDKIKSFLEQKIRQIEEEIDKETKLGANKNH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (161)
Sequences:	164 (112)
Seq/√Len:	8.8

HALSA - TFE
SULSO - TFE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
110_K	156_E	4.455	0.99
103_K	163_E	4.344	0.99
92_L	166_I	3.529	0.96
58_E	63_V	2.979	0.90
99_L	159_I	2.776	0.86
108_Y	114_F	2.675	0.84
33_E	66_R	2.566	0.81
108_Y	112_N	2.502	0.79
85_D	162_I	2.416	0.77
35_T	70_D	2.364	0.75
103_K	133_E	2.156	0.68
124_Y	128_E	2.127	0.67
23_V	45_I	2.098	0.66
102_L	105_R	2.090	0.65
102_L	159_I	1.955	0.60
55_N	76_F	1.871	0.56
100_D	104_T	1.846	0.55
5_E	87_I	1.827	0.54
44_N	91_L	1.824	0.54
6_D	32_T	1.800	0.53
148_T	152_K	1.787	0.53
19_D	43_L	1.751	0.51
11_L	79_Y	1.731	0.50
105_R	114_F	1.723	0.50
8_F	12_A	1.702	0.49
44_N	137_L	1.676	0.48
99_L	157_Q	1.578	0.44
5_E	42_Q	1.554	0.43
17_G	115_F	1.527	0.42
37_E	50_V	1.514	0.41
11_L	158_K	1.463	0.39
5_E	25_R	1.458	0.39
50_V	134_F	1.452	0.39
18_D	161_Q	1.402	0.36
33_E	59_E	1.401	0.36
65_Y	72_D	1.395	0.36
17_G	74_G	1.392	0.36
61_G	65_Y	1.389	0.36
39_I	166_I	1.380	0.36
19_D	103_K	1.365	0.35
56_L	110_K	1.358	0.35
15_L	141_S	1.330	0.34
149_D	156_E	1.329	0.34
50_V	63_V	1.317	0.33
6_D	9_I	1.307	0.33
36_D	131_E	1.271	0.31
62_F	115_F	1.246	0.31
132_N	143_L	1.225	0.30
24_L	127_E	1.223	0.30
14_S	23_V	1.215	0.29
106_L	127_E	1.214	0.29
43_L	116_I	1.213	0.29
62_F	78_Y	1.208	0.29
12_A	79_Y	1.196	0.29
106_L	109_E	1.179	0.28
43_L	135_K	1.174	0.28
78_Y	139_C	1.148	0.27
97_L	125_S	1.147	0.27
52_K	167_D	1.142	0.27
40_A	78_Y	1.142	0.27
6_D	93_N	1.130	0.26
15_L	56_L	1.127	0.26
14_S	34_M	1.123	0.26
156_E	160_R	1.118	0.26
70_D	75_W	1.112	0.26
55_N	78_Y	1.105	0.26
105_R	108_Y	1.102	0.26
67_K	148_T	1.091	0.25
43_L	71_K	1.090	0.25
18_D	162_I	1.087	0.25
104_T	141_S	1.076	0.25
15_L	91_L	1.076	0.25
88_N	148_T	1.071	0.25
17_G	69_R	1.070	0.25
36_D	99_L	1.065	0.24
13_K	18_D	1.063	0.24
12_A	16_L	1.061	0.24
111_N	118_P	1.049	0.24
43_L	120_D	1.039	0.24
67_K	78_Y	1.028	0.23
50_V	126_F	1.022	0.23
153_S	160_R	0.989	0.22
7_L	18_D	0.981	0.22
106_L	152_K	0.981	0.22
63_V	67_K	0.977	0.22
115_F	154_F	0.972	0.22
126_F	134_F	0.962	0.21
19_D	98_I	0.950	0.21
65_Y	86_Q	0.942	0.21
55_N	75_W	0.941	0.21
59_E	69_R	0.940	0.21
133_E	161_Q	0.937	0.21
102_L	109_E	0.935	0.20
118_P	122_S	0.934	0.20
26_I	112_N	0.930	0.20
47_V	114_F	0.927	0.20
106_L	137_L	0.924	0.20
18_D	29_D	0.920	0.20
67_K	70_D	0.918	0.20
29_D	38_E	0.916	0.20
39_I	152_K	0.912	0.20
37_E	149_D	0.912	0.20
36_D	56_L	0.896	0.19
82_P	138_K	0.895	0.19
62_F	67_K	0.890	0.19
47_V	75_W	0.888	0.19
48_N	75_W	0.883	0.19
35_T	52_K	0.876	0.19
133_E	151_I	0.876	0.19
33_E	40_A	0.858	0.18
27_L	97_L	0.856	0.18
140_G	150_K	0.847	0.18
62_F	131_E	0.846	0.18
17_G	36_D	0.831	0.18
51_R	136_C	0.831	0.18
138_K	156_E	0.828	0.18
79_Y	94_R	0.826	0.18
52_K	76_F	0.821	0.17
69_R	74_G	0.814	0.17
100_D	133_E	0.809	0.17
100_D	141_S	0.806	0.17
23_V	34_M	0.804	0.17
29_D	64_S	0.803	0.17
50_V	58_E	0.803	0.17
33_E	62_F	0.801	0.17
93_N	141_S	0.799	0.17
12_A	159_I	0.794	0.17
8_F	32_T	0.792	0.17
118_P	124_Y	0.788	0.17
109_E	148_T	0.785	0.17
59_E	76_F	0.783	0.17
11_L	76_F	0.782	0.17
67_K	75_W	0.780	0.16
101_K	115_F	0.779	0.16
50_V	67_K	0.779	0.16
47_V	58_E	0.771	0.16
70_D	74_G	0.771	0.16
117_C	136_C	0.770	0.16
51_R	117_C	0.770	0.16
59_E	94_R	0.764	0.16
67_K	109_E	0.763	0.16
18_D	104_T	0.763	0.16
93_N	115_F	0.760	0.16
33_E	91_L	0.756	0.16
86_Q	105_R	0.755	0.16
86_Q	115_F	0.748	0.16
47_V	110_K	0.745	0.16
160_R	164_E	0.742	0.16
142_Q	152_K	0.738	0.15
61_G	158_K	0.738	0.15
85_D	124_Y	0.728	0.15
38_E	155_L	0.717	0.15
36_D	63_V	0.715	0.15
87_I	128_E	0.707	0.15
109_E	126_F	0.705	0.15
73_S	98_I	0.703	0.15
74_G	158_K	0.691	0.14
12_A	24_L	0.685	0.14
108_Y	164_E	0.683	0.14
64_S	76_F	0.683	0.14
61_G	83_N	0.680	0.14
135_K	140_G	0.679	0.14
74_G	113_T	0.678	0.14
103_K	128_E	0.677	0.14
23_V	133_E	0.674	0.14
32_T	147_D	0.673	0.14
76_F	94_R	0.671	0.14
104_T	152_K	0.668	0.14
104_T	127_E	0.665	0.14
131_E	143_L	0.664	0.14
11_L	114_F	0.661	0.14
58_E	73_S	0.661	0.14
67_K	73_S	0.661	0.14
18_D	97_L	0.651	0.14
52_K	64_S	0.650	0.14
10_N	60_Q	0.645	0.14
74_G	79_Y	0.644	0.13
22_D	89_E	0.637	0.13
16_L	21_I	0.634	0.13
9_I	85_D	0.632	0.13
124_Y	130_F	0.630	0.13
117_C	139_C	0.629	0.13
88_N	140_G	0.628	0.13
143_L	149_D	0.626	0.13
137_L	144_T	0.621	0.13
22_D	127_E	0.619	0.13
90_I	107_E	0.617	0.13
51_R	54_L	0.614	0.13
54_L	136_C	0.614	0.13
123_R	148_T	0.611	0.13
38_E	50_V	0.610	0.13
50_V	73_S	0.608	0.13
35_T	50_V	0.608	0.13
115_F	124_Y	0.605	0.13
58_E	67_K	0.604	0.13
48_N	134_F	0.602	0.13
89_E	131_E	0.601	0.13
37_E	43_L	0.600	0.13
9_I	12_A	0.600	0.13
95_K	165_E	0.598	0.13
54_L	57_L	0.594	0.13
141_S	153_S	0.594	0.13
105_R	112_N	0.594	0.13
102_L	106_L	0.582	0.12
16_L	155_L	0.580	0.12
131_E	134_F	0.576	0.12
47_V	79_Y	0.571	0.12
48_N	114_F	0.571	0.12
10_N	83_N	0.570	0.12
81_K	111_N	0.569	0.12
35_T	131_E	0.568	0.12
21_I	153_S	0.567	0.12
39_I	139_C	0.567	0.12
84_I	127_E	0.564	0.12
6_D	98_I	0.562	0.12
23_V	69_R	0.561	0.12
6_D	71_K	0.561	0.12
34_M	91_L	0.560	0.12
40_A	66_R	0.553	0.12
107_E	111_N	0.553	0.12
150_K	155_L	0.551	0.12
91_L	94_R	0.548	0.12
96_R	132_N	0.548	0.12
69_R	87_I	0.546	0.12
17_G	105_R	0.544	0.12
58_E	75_W	0.541	0.12
54_L	117_C	0.540	0.12
11_L	37_E	0.536	0.11
20_V	28_L	0.530	0.11
60_Q	115_F	0.530	0.11
99_L	162_I	0.525	0.11
154_F	160_R	0.523	0.11
12_A	77_I	0.522	0.11
5_E	8_F	0.522	0.11
23_V	68_T	0.521	0.11
16_L	118_P	0.515	0.11
73_S	130_F	0.512	0.11
32_T	82_P	0.510	0.11
96_R	105_R	0.509	0.11
26_I	53_K	0.506	0.11
39_I	133_E	0.503	0.11
124_Y	132_N	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xubA	1	0.7809	99.9	0.662	Contact Map
1q1hA	1	0.4775	99.2	0.8	Contact Map
1vd4A	1	0.3146	98.1	0.86	Contact Map
4qiwP	1	0.236	97.1	0.885	Contact Map
2w57A	2	0.5843	97	0.887	Contact Map
3r0aA	2	0.6348	96.7	0.89	Contact Map
2xigA	4	0.6461	96.7	0.89	Contact Map
3mwmA	2	0.5674	96.7	0.891	Contact Map
4aybP	1	0.2416	96.6	0.892	Contact Map
2o03A	2	0.5787	96.6	0.892	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.