PSB1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PSB1 - Proteasome subunit beta 1

UniProt:	Q980L4	Sequences: MEELPATAVGLKVNDGIVLASERRLSYGGYVLSKQAKKVYKINKFLMAGAGIYGDLQTLTRIMNVEIKYYEVSTGKPISVHAAAKLLSVILYQYKVMPFISEILFGGVDEKGPQLYVLDPIGSLIEDNYAAVGSGARIAIGVLESEYDPNMSLDVATQLITKAIKASIERDITSGDGIDLAIIDKKGNYENKFIPY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (183)
Sequences:	4309 (2406)
Seq/√Len:	177.9

HALSA - PSB PSA
SULSO - PSB1 PSB2 PSA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
152_S	155_V	5.238	1.00
20_A	160_I	3.710	1.00
14_N	150_N	3.227	1.00
10_G	19_L	3.063	1.00
13_V	16_G	2.764	1.00
8_A	48_A	2.519	1.00
10_G	115_L	2.517	1.00
114_Q	126_E	2.448	1.00
153_L	184_D	2.430	1.00
146_E	162_K	2.421	1.00
13_V	156_A	2.407	1.00
184_D	187_G	2.359	1.00
71_E	77_P	2.336	1.00
46_L	80_V	2.226	1.00
128_N	149_P	2.213	1.00
153_L	157_T	2.103	1.00
41_K	44_K	2.092	1.00
109_D	112_G	2.050	1.00
19_L	106_G	2.009	1.00
148_D	155_V	1.928	1.00
151_M	159_L	1.926	1.00
11_L	160_I	1.913	1.00
15_D	185_K	1.863	1.00
43_N	71_E	1.838	1.00
12_K	126_E	1.829	1.00
104_L	130_A	1.796	1.00
17_I	106_G	1.785	1.00
92_Y	95_K	1.778	1.00
14_N	152_S	1.759	1.00
80_V	107_G	1.737	1.00
18_V	182_I	1.702	1.00
46_L	83_A	1.660	1.00
18_V	157_T	1.651	1.00
45_F	77_P	1.630	1.00
18_V	160_I	1.612	1.00
148_D	151_M	1.569	1.00
146_E	159_L	1.567	1.00
79_S	82_A	1.548	1.00
11_L	156_A	1.519	1.00
157_T	180_L	1.481	1.00
67_I	83_A	1.481	1.00
157_T	182_I	1.479	1.00
15_D	153_L	1.458	1.00
39_V	181_A	1.458	1.00
13_V	153_L	1.457	1.00
13_V	184_D	1.446	1.00
102_E	120_P	1.433	1.00
63_M	87_L	1.402	1.00
116_Y	126_E	1.398	1.00
16_G	156_A	1.380	1.00
84_A	124_L	1.379	1.00
158_Q	162_K	1.377	1.00
37_K	179_D	1.375	1.00
49_G	56_L	1.362	1.00
147_Y	150_N	1.359	1.00
7_T	135_G	1.328	1.00
25_L	36_A	1.291	1.00
97_M	100_I	1.248	1.00
47_M	60_T	1.247	1.00
12_K	128_N	1.235	1.00
78_I	83_A	1.207	1.00
147_Y	151_M	1.197	1.00
62_I	66_E	1.193	1.00
43_N	77_P	1.193	1.00
143_L	163_A	1.189	1.00
20_A	180_L	1.171	1.00
18_V	156_A	1.170	1.00
94_Y	99_F	1.164	1.00
59_L	101_S	1.162	1.00
131_A	143_L	1.154	1.00
66_E	86_L	1.153	1.00
142_V	163_A	1.150	1.00
47_M	105_F	1.146	1.00
12_K	113_P	1.142	1.00
66_E	69_Y	1.141	1.00
39_V	48_A	1.131	1.00
142_V	146_E	1.123	1.00
42_I	67_I	1.086	1.00
7_T	139_A	1.081	1.00
16_G	153_L	1.072	1.00
70_Y	74_T	1.069	1.00
108_V	185_K	1.064	1.00
62_I	90_I	1.062	1.00
104_L	132_V	1.035	1.00
154_D	158_Q	1.021	0.99
161_T	178_I	1.021	0.99
17_I	115_L	1.017	0.99
23_R	179_D	1.008	0.99
91_L	118_L	1.007	0.99
65_V	69_Y	0.996	0.99
27_Y	32_L	0.988	0.99
119_D	123_S	0.983	0.99
24_R	31_V	0.983	0.99
151_M	155_V	0.981	0.99
162_K	165_K	0.980	0.99
42_I	47_M	0.980	0.99
117_V	130_A	0.978	0.99
40_Y	60_T	0.978	0.99
86_L	90_I	0.968	0.99
19_L	181_A	0.962	0.99
158_Q	161_T	0.960	0.99
9_V	143_L	0.958	0.99
91_L	103_I	0.954	0.99
161_T	180_L	0.952	0.99
60_T	64_N	0.952	0.99
151_M	156_A	0.951	0.99
129_Y	143_L	0.948	0.99
17_I	113_P	0.928	0.99
105_F	118_L	0.911	0.99
90_I	93_Q	0.905	0.99
17_I	20_A	0.895	0.99
43_N	46_L	0.894	0.99
69_Y	73_S	0.892	0.99
19_L	48_A	0.891	0.98
45_F	78_I	0.891	0.98
56_L	101_S	0.890	0.98
163_A	167_S	0.887	0.98
69_Y	72_V	0.878	0.98
109_D	114_Q	0.878	0.98
50_A	132_V	0.875	0.98
47_M	103_I	0.864	0.98
127_D	130_A	0.853	0.98
80_V	114_Q	0.851	0.98
23_R	177_G	0.844	0.98
40_Y	49_G	0.842	0.98
87_L	105_F	0.837	0.98
78_I	82_A	0.834	0.98
154_D	157_T	0.827	0.98
21_S	50_A	0.827	0.98
108_V	113_P	0.825	0.98
79_S	110_E	0.825	0.98
104_L	115_L	0.824	0.97
142_V	159_L	0.808	0.97
139_A	163_A	0.806	0.97
108_V	183_I	0.806	0.97
40_Y	58_T	0.802	0.97
155_V	158_Q	0.802	0.97
162_K	166_A	0.790	0.97
165_K	168_I	0.790	0.97
131_A	139_A	0.789	0.97
8_A	21_S	0.787	0.97
65_V	68_K	0.786	0.97
70_Y	79_S	0.786	0.97
106_G	183_I	0.783	0.97
26_S	31_V	0.777	0.96
144_E	170_R	0.771	0.96
24_R	175_G	0.767	0.96
68_K	71_E	0.767	0.96
102_E	132_V	0.762	0.96
78_I	86_L	0.761	0.96
153_L	156_A	0.760	0.96
89_V	93_Q	0.757	0.96
111_K	114_Q	0.757	0.96
46_L	105_F	0.749	0.96
6_A	22_E	0.742	0.95
171_D	174_S	0.741	0.95
24_R	134_S	0.739	0.95
129_Y	140_I	0.735	0.95
155_V	159_L	0.735	0.95
45_F	110_E	0.734	0.95
120_P	132_V	0.730	0.95
142_V	166_A	0.724	0.95
44_K	77_P	0.724	0.95
55_D	98_P	0.722	0.95
84_A	116_Y	0.722	0.95
76_K	110_E	0.720	0.95
95_K	100_I	0.718	0.94
9_V	30_Y	0.716	0.94
52_I	55_D	0.712	0.94
9_V	160_I	0.711	0.94
81_H	111_K	0.704	0.94
101_S	143_L	0.696	0.94
42_I	64_N	0.686	0.93
53_Y	56_L	0.685	0.93
59_L	87_L	0.683	0.93
152_S	156_A	0.680	0.93
8_A	104_L	0.670	0.92
70_Y	82_A	0.667	0.92
171_D	175_G	0.666	0.92
79_S	84_A	0.666	0.92
167_S	171_D	0.665	0.92
18_V	153_L	0.663	0.92
54_G	123_S	0.656	0.91
49_G	54_G	0.655	0.91
87_L	103_I	0.653	0.91
49_G	103_I	0.651	0.91
5_P	107_G	0.648	0.91
21_S	39_V	0.648	0.91
88_S	124_L	0.646	0.91
111_K	185_K	0.642	0.91
97_M	101_S	0.641	0.90
50_A	123_S	0.641	0.90
51_G	55_D	0.637	0.90
68_K	72_V	0.636	0.90
117_V	127_D	0.636	0.90
153_L	182_I	0.636	0.90
19_L	39_V	0.633	0.90
70_Y	78_I	0.632	0.90
80_V	105_F	0.621	0.89
70_Y	91_L	0.620	0.89
92_Y	97_M	0.619	0.89
13_V	182_I	0.616	0.89
69_Y	141_G	0.616	0.89
68_K	73_S	0.615	0.89
90_I	99_F	0.614	0.88
63_M	86_L	0.607	0.88
52_I	58_T	0.604	0.88
161_T	164_I	0.604	0.88
82_A	85_K	0.602	0.87
38_K	147_Y	0.597	0.87
117_V	125_I	0.589	0.86
11_L	159_L	0.585	0.86
135_G	139_A	0.582	0.86
62_I	86_L	0.581	0.86
51_G	122_G	0.579	0.85
56_L	60_T	0.576	0.85
154_D	186_K	0.574	0.85
41_K	45_F	0.572	0.85
62_I	65_V	0.562	0.84
123_S	130_A	0.562	0.84
66_E	90_I	0.559	0.83
142_V	162_K	0.559	0.83
67_I	89_V	0.558	0.83
10_G	106_G	0.558	0.83
110_E	185_K	0.555	0.83
116_Y	124_L	0.555	0.83
43_N	78_I	0.551	0.83
11_L	147_Y	0.547	0.82
5_P	57_Q	0.545	0.82
161_T	165_K	0.544	0.82
157_T	161_T	0.544	0.82
122_G	133_G	0.544	0.82
24_R	171_D	0.542	0.81
94_Y	118_L	0.541	0.81
48_A	140_I	0.541	0.81
59_L	99_F	0.540	0.81
38_K	134_S	0.539	0.81
16_G	152_S	0.537	0.81
38_K	50_A	0.536	0.81
108_V	187_G	0.534	0.81
39_V	179_D	0.532	0.80
37_K	40_Y	0.532	0.80
85_K	124_L	0.528	0.80
87_L	118_L	0.527	0.80
9_V	20_A	0.526	0.80
23_R	164_I	0.526	0.80
81_H	114_Q	0.524	0.79
15_D	184_D	0.524	0.79
110_E	187_G	0.524	0.79
91_L	124_L	0.523	0.79
134_S	138_I	0.522	0.79
95_K	129_Y	0.520	0.79
11_L	14_N	0.519	0.79
42_I	83_A	0.518	0.79
59_L	91_L	0.517	0.78
138_I	141_G	0.516	0.78
24_R	174_S	0.514	0.78
42_I	63_M	0.512	0.78
118_L	125_I	0.511	0.78
53_Y	137_R	0.510	0.77
93_Q	158_Q	0.510	0.77
17_I	183_I	0.510	0.77
73_S	82_A	0.510	0.77
168_I	171_D	0.509	0.77
63_M	95_K	0.508	0.77
131_A	140_I	0.507	0.77
61_R	64_N	0.506	0.77
126_E	130_A	0.503	0.76
121_I	129_Y	0.503	0.76
54_G	169_E	0.502	0.76
12_K	17_I	0.502	0.76
140_I	170_R	0.501	0.76
67_I	74_T	0.501	0.76
153_L	172_I	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4r3oJ	1	0.9949	100	0.161	Contact Map
3h4pa	5	0.9745	100	0.168	Contact Map
4r3oM	1	0.9949	100	0.168	Contact Map
1rypJ	1	0.9949	100	0.172	Contact Map
1yarH	5	0.9694	100	0.173	Contact Map
1j2qH	5	0.9745	100	0.174	Contact Map
4r3oB	1	0.9898	100	0.178	Contact Map
1rypM	1	0.9949	100	0.18	Contact Map
3nzjK	1	0.9745	100	0.181	Contact Map
3nzjH	1	0.9694	100	0.181	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.