Q980K2 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980K2 - DNA-directed RNA polymerase subunit

UniProt:	Q980K2	Sequences: MIVVKFCPKCNSMMVPKKSNGKNVYRCTKCGYEKEVPETTIVVTSKVKHSIKEKTLVLEEEEMPSGAQKIKGVLCPSCKNDEAYFWILQTRRADEPPTRFYKCTKCGKVWREYE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	114 (104)
Sequences:	648 (443)
Seq/√Len:	43.4

HALSA - Q9HS34 Q9HP96
SULSO - Q980K2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_N	104_T	4.910	1.00
69_K	82_E	3.502	1.00
87_I	99_R	3.340	1.00
102_K	109_V	3.241	1.00
5_K	34_K	2.756	1.00
24_V	33_E	2.493	1.00
87_I	97_P	2.462	1.00
77_S	108_K	2.173	1.00
90_T	96_P	2.103	0.99
64_P	67_A	1.925	0.99
18_K	23_N	1.920	0.99
55_T	59_E	1.908	0.99
72_G	82_E	1.898	0.99
102_K	107_G	1.878	0.99
74_L	81_D	1.783	0.98
86_W	109_V	1.745	0.98
67_A	102_K	1.699	0.98
8_P	32_Y	1.691	0.97
62_E	65_S	1.629	0.97
72_G	81_D	1.618	0.97
103_C	106_C	1.580	0.96
106_C	110_W	1.568	0.96
12_S	29_K	1.565	0.96
95_E	98_T	1.527	0.95
84_Y	104_T	1.466	0.94
86_W	102_K	1.399	0.93
7_C	10_C	1.382	0.92
83_A	110_W	1.380	0.92
81_D	105_K	1.353	0.91
38_E	50_S	1.346	0.91
91_R	94_D	1.327	0.90
96_P	101_Y	1.316	0.90
67_A	85_F	1.277	0.89
21_G	35_E	1.261	0.88
64_P	68_Q	1.223	0.86
99_R	112_E	1.214	0.86
17_K	24_V	1.195	0.85
56_L	60_E	1.179	0.84
55_T	58_L	1.174	0.84
15_V	28_T	1.162	0.83
70_I	85_F	1.162	0.83
56_L	59_E	1.152	0.83
85_F	97_P	1.124	0.81
83_A	101_Y	1.073	0.78
54_K	58_L	1.064	0.78
83_A	87_I	1.057	0.77
79_K	105_K	1.056	0.77
80_N	105_K	1.041	0.76
6_F	10_C	1.038	0.76
105_K	109_V	1.035	0.76
57_V	60_E	0.986	0.72
73_V	76_P	0.961	0.70
72_G	108_K	0.956	0.70
103_C	110_W	0.955	0.69
9_K	79_K	0.944	0.69
93_A	112_E	0.943	0.68
12_S	31_G	0.934	0.68
53_E	57_V	0.927	0.67
4_V	25_Y	0.925	0.67
18_K	22_K	0.915	0.66
51_I	59_E	0.914	0.66
44_T	47_V	0.913	0.66
66_G	102_K	0.907	0.65
72_G	79_K	0.902	0.65
9_K	105_K	0.875	0.63
94_D	98_T	0.849	0.60
73_V	77_S	0.839	0.59
61_E	68_Q	0.826	0.58
7_C	78_C	0.824	0.58
28_T	36_V	0.805	0.56
74_L	79_K	0.802	0.56
25_Y	29_K	0.797	0.55
46_K	101_Y	0.795	0.55
52_K	56_L	0.769	0.53
90_T	98_T	0.757	0.52
43_V	49_H	0.756	0.52
46_K	49_H	0.749	0.51
42_V	45_S	0.739	0.50
16_P	34_K	0.736	0.50
12_S	15_V	0.727	0.49
31_G	97_P	0.726	0.49
8_P	95_E	0.721	0.48
43_V	48_K	0.720	0.48
76_P	91_R	0.720	0.48
35_E	42_V	0.719	0.48
60_E	63_M	0.705	0.47
59_E	64_P	0.704	0.47
9_K	14_M	0.698	0.46
52_K	55_T	0.698	0.46
9_K	13_M	0.691	0.45
17_K	36_V	0.689	0.45
16_P	23_N	0.688	0.45
97_P	112_E	0.684	0.45
88_L	98_T	0.683	0.45
21_G	79_K	0.677	0.44
63_M	68_Q	0.667	0.43
61_E	80_N	0.666	0.43
64_P	70_I	0.662	0.43
79_K	82_E	0.657	0.42
7_C	30_C	0.657	0.42
73_V	112_E	0.656	0.42
90_T	112_E	0.655	0.42
22_K	28_T	0.654	0.42
67_A	84_Y	0.653	0.42
69_K	104_T	0.652	0.42
54_K	60_E	0.650	0.41
62_E	93_A	0.639	0.40
95_E	110_W	0.639	0.40
81_D	101_Y	0.636	0.40
61_E	65_S	0.631	0.40
87_I	107_G	0.621	0.39
29_K	86_W	0.616	0.38
8_P	110_W	0.611	0.38
60_E	64_P	0.609	0.38
37_P	101_Y	0.609	0.38
30_C	78_C	0.608	0.38
46_K	81_D	0.605	0.37
4_V	76_P	0.604	0.37
89_Q	93_A	0.598	0.37
79_K	109_V	0.597	0.37
29_K	109_V	0.592	0.36
12_S	87_I	0.581	0.35
92_R	95_E	0.578	0.35
16_P	36_V	0.576	0.35
70_I	73_V	0.575	0.35
49_H	52_K	0.573	0.35
68_Q	83_A	0.567	0.34
54_K	59_E	0.567	0.34
6_F	80_N	0.565	0.34
100_F	111_R	0.565	0.34
23_N	80_N	0.561	0.34
32_Y	35_E	0.556	0.33
18_K	48_K	0.554	0.33
23_N	27_C	0.553	0.33
88_L	109_V	0.546	0.32
94_D	100_F	0.544	0.32
21_G	105_K	0.543	0.32
16_P	35_E	0.542	0.32
14_M	99_R	0.540	0.32
33_E	38_E	0.539	0.32
53_E	108_K	0.537	0.32
81_D	104_T	0.532	0.31
31_G	59_E	0.530	0.31
87_I	91_R	0.530	0.31
24_V	44_T	0.529	0.31
92_R	97_P	0.527	0.31
17_K	26_R	0.524	0.30
36_V	43_V	0.522	0.30
59_E	102_K	0.522	0.30
88_L	97_P	0.519	0.30
89_Q	95_E	0.518	0.30
5_K	14_M	0.514	0.30
29_K	101_Y	0.507	0.29
80_N	83_A	0.501	0.29
37_P	61_E	0.501	0.29
53_E	70_I	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1twfI	1	0.9825	100	0.226	Contact Map
3h0gI	1	0.9561	100	0.232	Contact Map
4c2mI	1	0.9825	100	0.236	Contact Map
3qt1I	1	0.3947	100	0.254	Contact Map
1qypA	1	0.5	99.8	0.555	Contact Map
4cgyA	1	0	99.8	0.566	Contact Map
1tfiA	1	0.4386	99.7	0.587	Contact Map
1pqvS	1	0.9211	99.7	0.59	Contact Map
3po3S	1	0.9211	99.7	0.606	Contact Map
2fiyA	1	0.6842	97.3	0.83	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.