RL10E - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RL10E - 50S ribosomal protein L10e

UniProt:	Q980J7	Sequences: MPLRPGRCYRHFSGPAYTRKEYIPGIPQPKITKFTSGNPNGDYDYEVRLITTEIGQIRHNALEAVRTLTLKTLSKKTGSETSFFMWILKYPHHVLRENKMMAFAGADRLQDGMRLSFGTPIGTAARIEKLGETLIVIKVKKEHLEFAKEALKIASKKLPLRTRIEIIPLRLVRQEVQS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	178 (167)
Sequences:	320 (176)
Seq/√Len:	13.6

HALSA - RL10E
SULSO - RL10E

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
89_K	132_E	3.814	0.99
73_L	137_I	3.735	0.99
4_R	8_C	3.223	0.98
72_T	153_I	3.054	0.97
17_Y	117_F	2.942	0.97
73_L	77_T	2.808	0.96
77_T	82_S	2.805	0.96
139_V	147_A	2.597	0.93
87_I	135_I	2.427	0.91
69_T	154_A	2.422	0.91
16_A	93_H	2.283	0.88
35_T	86_W	2.279	0.88
98_N	109_L	2.158	0.84
86_W	152_K	2.128	0.84
73_L	147_A	2.083	0.82
95_L	124_A	2.081	0.82
1_M	5_P	1.974	0.79
22_Y	111_D	1.947	0.78
59_H	123_T	1.930	0.77
100_M	109_L	1.856	0.74
139_V	143_H	1.838	0.73
16_A	46_E	1.826	0.73
98_N	110_Q	1.826	0.73
35_T	84_F	1.817	0.72
149_E	152_K	1.778	0.71
144_L	169_L	1.773	0.70
73_L	139_V	1.758	0.70
4_R	116_S	1.752	0.69
151_L	159_P	1.724	0.68
149_E	153_I	1.710	0.68
34_F	145_E	1.705	0.67
145_E	164_I	1.661	0.65
144_L	147_A	1.647	0.64
74_S	83_F	1.646	0.64
77_T	85_M	1.617	0.63
85_M	135_I	1.590	0.62
52_T	163_R	1.584	0.61
96_R	114_R	1.523	0.58
71_K	109_L	1.518	0.58
116_S	123_T	1.480	0.56
4_R	121_I	1.469	0.55
73_L	94_V	1.465	0.55
105_G	108_R	1.441	0.54
47_V	147_A	1.439	0.54
127_I	132_E	1.414	0.52
101_M	110_Q	1.338	0.48
3_L	10_R	1.322	0.48
101_M	109_L	1.320	0.47
23_I	94_V	1.318	0.47
147_A	159_P	1.266	0.45
12_F	54_I	1.265	0.45
8_C	110_Q	1.255	0.44
92_H	164_I	1.251	0.44
72_T	149_E	1.241	0.43
25_G	53_E	1.231	0.43
51_T	160_L	1.225	0.42
57_I	144_L	1.203	0.41
66_R	96_R	1.194	0.41
5_P	9_Y	1.186	0.40
4_R	24_P	1.179	0.40
7_R	100_M	1.165	0.39
8_C	101_M	1.137	0.38
32_T	120_P	1.129	0.37
33_K	101_M	1.127	0.37
11_H	14_G	1.125	0.37
36_S	164_I	1.099	0.36
26_I	123_T	1.096	0.36
139_V	159_P	1.094	0.36
16_A	39_P	1.091	0.36
13_S	30_K	1.083	0.35
31_I	34_F	1.083	0.35
87_I	166_I	1.048	0.34
54_I	68_L	1.039	0.33
11_H	15_P	1.034	0.33
29_P	123_T	1.022	0.32
25_G	154_A	1.020	0.32
69_T	147_A	1.014	0.32
61_A	64_A	1.011	0.32
14_G	126_R	1.004	0.31
4_R	7_R	1.002	0.31
19_R	23_I	0.996	0.31
137_I	147_A	0.991	0.31
8_C	100_M	0.988	0.31
77_T	146_F	0.986	0.31
70_L	127_I	0.974	0.30
50_I	64_A	0.969	0.30
98_N	114_R	0.966	0.30
62_L	89_K	0.966	0.30
69_T	85_M	0.956	0.29
70_L	125_A	0.955	0.29
36_S	142_E	0.947	0.29
92_H	148_K	0.941	0.29
128_E	159_P	0.938	0.28
72_T	93_H	0.935	0.28
24_P	55_G	0.925	0.28
85_M	147_A	0.915	0.27
100_M	110_Q	0.911	0.27
58_R	124_A	0.907	0.27
68_L	74_S	0.890	0.26
64_A	93_H	0.887	0.26
69_T	137_I	0.886	0.26
64_A	122_G	0.882	0.26
103_F	109_L	0.877	0.26
41_G	83_F	0.874	0.26
4_R	160_L	0.868	0.26
23_I	117_F	0.864	0.25
7_R	98_N	0.864	0.25
47_V	166_I	0.850	0.25
38_N	82_S	0.848	0.25
56_Q	63_E	0.845	0.25
56_Q	126_R	0.844	0.25
57_I	68_L	0.839	0.24
3_L	15_P	0.839	0.24
3_L	60_N	0.833	0.24
148_K	168_P	0.830	0.24
17_Y	23_I	0.823	0.24
6_G	115_L	0.818	0.24
49_L	96_R	0.812	0.23
133_T	164_I	0.806	0.23
48_R	88_L	0.805	0.23
15_P	93_H	0.800	0.23
147_A	164_I	0.798	0.23
61_A	94_V	0.797	0.23
53_E	130_L	0.792	0.23
49_L	57_I	0.790	0.22
96_R	107_D	0.789	0.22
104_A	107_D	0.787	0.22
62_L	65_V	0.781	0.22
92_H	101_M	0.780	0.22
36_S	57_I	0.774	0.22
93_H	123_T	0.764	0.22
69_T	139_V	0.763	0.22
51_T	54_I	0.758	0.21
83_F	133_T	0.753	0.21
6_G	88_L	0.749	0.21
100_M	155_S	0.747	0.21
26_I	67_T	0.745	0.21
97_E	121_I	0.742	0.21
103_F	110_Q	0.741	0.21
107_D	112_G	0.739	0.21
50_I	165_E	0.739	0.21
99_K	105_G	0.739	0.21
8_C	102_A	0.739	0.21
48_R	51_T	0.738	0.21
30_K	59_H	0.737	0.21
95_L	144_L	0.736	0.21
49_L	150_A	0.733	0.20
45_Y	57_I	0.726	0.20
55_G	110_Q	0.723	0.20
18_T	46_E	0.720	0.20
65_V	158_L	0.718	0.20
32_T	39_P	0.713	0.20
26_I	29_P	0.707	0.20
104_A	108_R	0.706	0.20
89_K	95_L	0.703	0.19
24_P	153_I	0.698	0.19
85_M	152_K	0.697	0.19
148_K	158_L	0.690	0.19
145_E	165_E	0.687	0.19
42_D	87_I	0.685	0.19
141_K	168_P	0.684	0.19
39_P	86_W	0.680	0.19
62_L	73_L	0.678	0.19
54_I	130_L	0.678	0.19
3_L	8_C	0.674	0.18
57_I	135_I	0.672	0.18
50_I	134_L	0.670	0.18
35_T	162_T	0.666	0.18
6_G	153_I	0.665	0.18
3_L	86_W	0.656	0.18
66_R	118_G	0.655	0.18
53_E	75_K	0.654	0.18
68_L	71_K	0.652	0.18
22_Y	135_I	0.651	0.18
31_I	87_I	0.648	0.18
56_Q	124_A	0.646	0.18
31_I	131_G	0.645	0.18
88_L	161_R	0.644	0.18
109_L	120_P	0.639	0.17
2_P	102_A	0.632	0.17
44_D	84_F	0.627	0.17
86_W	130_L	0.625	0.17
40_N	143_H	0.622	0.17
13_S	120_P	0.619	0.17
83_F	141_K	0.619	0.17
29_P	141_K	0.618	0.17
4_R	161_R	0.617	0.17
8_C	60_N	0.617	0.17
6_G	116_S	0.616	0.17
128_E	149_E	0.612	0.17
43_Y	85_M	0.609	0.16
29_P	87_I	0.603	0.16
64_A	138_K	0.603	0.16
142_E	145_E	0.601	0.16
47_V	95_L	0.599	0.16
120_P	158_L	0.597	0.16
32_T	79_S	0.595	0.16
31_I	77_T	0.594	0.16
35_T	43_Y	0.593	0.16
3_L	11_H	0.591	0.16
23_I	55_G	0.590	0.16
7_R	120_P	0.584	0.16
98_N	120_P	0.583	0.16
57_I	134_L	0.583	0.16
36_S	45_Y	0.583	0.16
77_T	143_H	0.578	0.16
15_P	59_H	0.576	0.16
84_F	158_L	0.576	0.16
28_Q	32_T	0.575	0.15
76_K	128_E	0.573	0.15
60_N	156_K	0.572	0.15
96_R	106_A	0.570	0.15
26_I	59_H	0.570	0.15
5_P	8_C	0.570	0.15
124_A	135_I	0.570	0.15
128_E	145_E	0.566	0.15
22_Y	137_I	0.565	0.15
31_I	166_I	0.563	0.15
150_A	159_P	0.559	0.15
48_R	136_V	0.556	0.15
63_E	104_A	0.555	0.15
94_V	169_L	0.553	0.15
77_T	127_I	0.553	0.15
41_G	44_D	0.552	0.15
95_L	99_K	0.551	0.15
52_T	68_L	0.547	0.15
8_C	109_L	0.547	0.15
22_Y	152_K	0.545	0.15
108_R	112_G	0.543	0.15
30_K	47_V	0.541	0.15
65_V	69_T	0.540	0.15
144_L	168_P	0.539	0.14
131_G	143_H	0.538	0.14
18_T	92_H	0.537	0.14
85_M	89_K	0.534	0.14
137_I	162_T	0.530	0.14
52_T	158_L	0.527	0.14
135_I	145_E	0.518	0.14
156_K	169_L	0.513	0.14
53_E	64_A	0.512	0.14
109_L	114_R	0.512	0.14
66_R	114_R	0.509	0.14
120_P	164_I	0.509	0.14
152_K	156_K	0.507	0.14
92_H	166_I	0.507	0.14
27_P	114_R	0.505	0.14
101_M	111_D	0.505	0.14
42_D	164_I	0.503	0.14
99_K	126_R	0.501	0.14
48_R	130_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4a17H	1	0.9213	100	0.265	Contact Map
3j39I	1	0.9831	100	0.266	Contact Map
3zf7K	1	0.9831	100	0.267	Contact Map
3j21N	1	0.9326	100	0.269	Contact Map
1vx7Q	1	0.8933	100	0.271	Contact Map
4ujqL	1	0.9326	100	0.278	Contact Map
1vq8H	1	0.8764	100	0.304	Contact Map
1ffkF	1	0.8708	100	0.392	Contact Map
2pa2A	1	0.5899	100	0.462	Contact Map
3j7yN	1	0.8258	100	0.541	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.