Q980H1 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980H1 - NADH dehydrogenase subunit I (NuoI)

UniProt:	Q980H1	Sequences: MEIFLSLSFSFLIIRCGGGLFMDKVKEYKKENIASLFAEHIQSIVTGIKYFVKPQRITLQYPEDSLTLPTGYRGMIRLYKDVCIGCTLCALICPADAMKMVTESGKKFPQINYGRCVFCGFCVDVCPVDALKETKVHDLVFNNRKQLIFDPDRFNVDIDDVPMQDKPVRKVKAIIDEKRGIKYVPADE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	188 (144)
Sequences:	601 (245)
Seq/√Len:	20.4

ECOLI - NUOI HYFH HYCF
HALSA - Q9HRL7
SULSO - Q980H1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
42_Q	45_V	3.620	1.00
68_L	137_H	3.412	1.00
85_G	102_T	2.962	0.99
92_I	125_V	2.770	0.99
114_G	147_L	2.758	0.99
125_V	130_A	2.708	0.99
43_S	47_G	2.653	0.98
106_K	109_P	2.389	0.97
40_H	44_I	2.330	0.96
31_E	34_A	2.284	0.96
48_I	51_F	2.243	0.95
70_T	135_K	2.169	0.94
118_F	146_Q	2.125	0.94
164_Q	168_V	2.099	0.93
38_A	42_Q	2.017	0.92
29_K	32_N	2.011	0.92
41_I	45_V	1.837	0.87
76_I	95_A	1.785	0.86
160_D	164_Q	1.757	0.85
40_H	43_S	1.743	0.84
123_V	133_E	1.729	0.84
29_K	33_I	1.690	0.82
166_K	170_K	1.658	0.81
143_N	146_Q	1.641	0.80
103_E	106_K	1.631	0.80
85_G	125_V	1.624	0.80
167_P	171_V	1.615	0.79
30_K	34_A	1.578	0.78
135_K	168_V	1.571	0.77
145_K	148_I	1.525	0.75
141_F	147_L	1.489	0.73
123_V	131_L	1.465	0.72
76_I	131_L	1.465	0.72
56_R	109_P	1.462	0.72
33_I	42_Q	1.442	0.71
111_I	117_V	1.403	0.69
116_C	126_C	1.399	0.68
64_D	135_K	1.366	0.67
167_P	170_K	1.350	0.66
75_M	141_F	1.309	0.63
122_C	126_C	1.301	0.63
59_L	67_T	1.280	0.61
88_L	102_T	1.225	0.58
40_H	46_T	1.220	0.58
103_E	107_K	1.213	0.57
52_V	171_V	1.211	0.57
144_R	148_I	1.203	0.56
141_F	146_Q	1.202	0.56
157_D	161_V	1.181	0.55
104_S	138_D	1.180	0.55
100_M	129_D	1.174	0.55
43_S	109_P	1.158	0.54
64_D	67_T	1.155	0.53
37_F	41_I	1.135	0.52
60_Q	63_E	1.130	0.52
49_K	163_M	1.128	0.52
145_K	150_D	1.126	0.51
149_F	157_D	1.120	0.51
112_N	115_R	1.111	0.50
78_L	154_F	1.095	0.49
97_A	111_I	1.079	0.48
117_V	131_L	1.077	0.48
168_V	172_K	1.074	0.48
141_F	148_I	1.067	0.48
33_I	36_L	1.066	0.48
113_Y	118_F	1.047	0.46
84_I	132_K	1.030	0.45
75_M	136_V	1.029	0.45
44_I	47_G	1.029	0.45
163_M	166_K	1.024	0.45
95_A	117_V	1.017	0.44
75_M	113_Y	1.001	0.43
170_K	173_A	0.987	0.42
34_A	38_A	0.975	0.42
163_M	167_P	0.970	0.41
45_V	49_K	0.952	0.40
138_D	147_L	0.947	0.40
110_Q	123_V	0.946	0.40
87_T	90_A	0.940	0.39
61_Y	138_D	0.937	0.39
101_V	108_F	0.934	0.39
100_M	112_N	0.911	0.38
78_L	124_D	0.910	0.38
81_D	88_L	0.907	0.37
102_T	113_Y	0.896	0.37
164_Q	169_R	0.892	0.36
97_A	109_P	0.886	0.36
119_C	122_C	0.886	0.36
98_M	131_L	0.878	0.36
84_I	128_V	0.868	0.35
64_D	152_D	0.866	0.35
75_M	146_Q	0.851	0.34
83_C	93_C	0.851	0.34
83_C	89_C	0.851	0.34
89_C	93_C	0.851	0.34
86_C	93_C	0.851	0.34
86_C	89_C	0.851	0.34
83_C	86_C	0.851	0.34
160_D	171_V	0.843	0.34
79_Y	95_A	0.842	0.33
30_K	33_I	0.840	0.33
93_C	119_C	0.835	0.33
86_C	119_C	0.835	0.33
83_C	119_C	0.835	0.33
89_C	119_C	0.835	0.33
117_V	124_D	0.830	0.33
149_F	153_R	0.830	0.33
100_M	115_R	0.829	0.33
136_V	141_F	0.826	0.33
71_G	80_K	0.824	0.32
81_D	90_A	0.812	0.32
73_R	154_F	0.804	0.31
58_T	62_P	0.802	0.31
97_A	117_V	0.801	0.31
87_T	91_L	0.798	0.31
85_G	95_A	0.792	0.31
156_V	170_K	0.788	0.30
42_Q	53_K	0.787	0.30
166_K	173_A	0.779	0.30
41_I	110_Q	0.761	0.29
65_S	137_H	0.761	0.29
57_I	137_H	0.758	0.29
65_S	138_D	0.751	0.28
57_I	102_T	0.740	0.28
136_V	157_D	0.739	0.28
48_I	57_I	0.738	0.28
45_V	70_T	0.737	0.28
33_I	38_A	0.733	0.27
38_A	163_M	0.730	0.27
51_F	146_Q	0.728	0.27
65_S	131_L	0.727	0.27
74_G	123_V	0.725	0.27
81_D	151_P	0.717	0.27
50_Y	53_K	0.714	0.26
35_S	49_K	0.713	0.26
93_C	116_C	0.713	0.26
83_C	116_C	0.713	0.26
89_C	116_C	0.713	0.26
86_C	116_C	0.713	0.26
143_N	150_D	0.710	0.26
53_K	60_Q	0.704	0.26
30_K	44_I	0.702	0.26
43_S	62_P	0.701	0.26
88_L	91_L	0.698	0.26
152_D	155_N	0.697	0.26
116_C	119_C	0.694	0.25
29_K	54_P	0.691	0.25
100_M	106_K	0.688	0.25
47_G	56_R	0.688	0.25
109_P	114_G	0.686	0.25
76_I	115_R	0.685	0.25
84_I	133_E	0.677	0.25
51_F	59_L	0.676	0.25
92_I	155_N	0.675	0.25
56_R	59_L	0.672	0.24
89_C	122_C	0.668	0.24
83_C	122_C	0.668	0.24
86_C	122_C	0.668	0.24
93_C	122_C	0.668	0.24
158_I	161_V	0.668	0.24
43_S	46_T	0.663	0.24
49_K	169_R	0.662	0.24
81_D	132_K	0.657	0.24
37_F	148_I	0.656	0.24
40_H	71_G	0.655	0.24
114_G	148_I	0.641	0.23
54_P	74_G	0.641	0.23
141_F	149_F	0.639	0.23
73_R	127_P	0.638	0.23
48_I	61_Y	0.638	0.23
78_L	95_A	0.634	0.23
57_I	134_T	0.631	0.22
95_A	109_P	0.622	0.22
50_Y	54_P	0.618	0.22
114_G	141_F	0.617	0.22
121_F	171_V	0.605	0.21
125_V	128_V	0.604	0.21
84_I	106_K	0.604	0.21
85_G	124_D	0.600	0.21
38_A	103_E	0.597	0.21
78_L	151_P	0.596	0.21
78_L	131_L	0.584	0.20
58_T	64_D	0.580	0.20
98_M	111_I	0.576	0.20
82_V	91_L	0.574	0.20
100_M	111_I	0.573	0.20
42_Q	60_Q	0.568	0.20
155_N	162_P	0.565	0.20
60_Q	66_L	0.564	0.20
73_R	76_I	0.562	0.19
63_E	136_V	0.561	0.19
98_M	154_F	0.560	0.19
37_F	124_D	0.559	0.19
83_C	126_C	0.547	0.19
89_C	126_C	0.547	0.19
86_C	126_C	0.547	0.19
93_C	126_C	0.547	0.19
46_T	92_I	0.546	0.19
95_A	128_V	0.545	0.19
53_K	142_N	0.541	0.19
163_M	171_V	0.541	0.19
113_Y	123_V	0.540	0.19
100_M	109_P	0.540	0.19
78_L	130_A	0.536	0.18
38_A	48_I	0.534	0.18
80_K	151_P	0.529	0.18
119_C	126_C	0.525	0.18
153_R	159_D	0.523	0.18
45_V	164_Q	0.521	0.18
34_A	170_K	0.516	0.18
52_V	149_F	0.513	0.18
150_D	153_R	0.509	0.17
151_P	154_F	0.506	0.17
158_I	165_D	0.504	0.17
136_V	149_F	0.503	0.17
68_L	168_V	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3i9v9	1	0.6755	99.9	0.588	Contact Map
1gteA	4	0.7128	99.5	0.754	Contact Map
1xerA	2	0.4947	99.5	0.754	Contact Map
5c4iB	1	0.6489	99.5	0.756	Contact Map
1hfeL	2	0.6968	99.4	0.763	Contact Map
1rgvA	1	0.3936	99.4	0.77	Contact Map
2fgoA	1	0.3989	99.4	0.771	Contact Map
2gmhA	1	0.75	99.4	0.771	Contact Map
3eunA	1	0.3989	99.4	0.772	Contact Map
1jb0C	1	0.4043	99.3	0.772	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.