Y352 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Y352 - DNA-binding protein SSO0352

UniProt:	Q980F8	Sequences: MSTPNSYDDEELEELLRRKAAQEQKRIEEERKRKAELESQKESILRVILTPEARQRLTNIKLVKPEFAESLENQLIALAQSGRIKIPITDEELKQILEQISQQNRRDFKIQIRERGWK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	118 (108)
Sequences:	446 (319)
Seq/√Len:	30.7

HALSA - Y2008
SULSO - Y352

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_I	75_L	3.510	1.00
41_K	69_E	2.956	1.00
31_R	35_A	2.943	1.00
14_E	17_R	2.825	1.00
31_R	34_K	2.448	0.99
21_A	24_Q	2.439	0.99
30_E	33_R	2.093	0.98
48_I	76_I	2.052	0.98
50_T	89_T	2.039	0.98
13_E	17_R	2.037	0.98
14_E	18_R	1.993	0.97
41_K	76_I	1.922	0.97
77_A	80_Q	1.913	0.96
9_D	12_L	1.882	0.96
71_L	89_T	1.803	0.95
37_L	41_K	1.778	0.95
60_I	93_L	1.749	0.94
59_N	63_V	1.694	0.93
84_I	88_I	1.692	0.93
22_Q	25_K	1.681	0.93
51_P	55_Q	1.593	0.91
44_I	73_N	1.588	0.90
55_Q	59_N	1.563	0.90
60_I	90_D	1.553	0.89
16_L	23_E	1.548	0.89
60_I	68_A	1.508	0.88
16_L	20_A	1.483	0.87
88_I	93_L	1.481	0.87
89_T	92_E	1.455	0.86
75_L	92_E	1.427	0.85
61_K	72_E	1.365	0.82
28_E	31_R	1.361	0.82
45_L	79_A	1.333	0.81
61_K	78_L	1.321	0.80
60_I	67_F	1.305	0.79
38_E	61_K	1.301	0.79
63_V	68_A	1.277	0.78
90_D	94_K	1.241	0.76
47_V	87_P	1.225	0.75
75_L	93_L	1.225	0.75
20_A	84_I	1.203	0.73
59_N	68_A	1.201	0.73
74_Q	78_L	1.192	0.73
20_A	23_E	1.154	0.70
52_E	90_D	1.121	0.68
28_E	32_K	1.095	0.66
77_A	81_S	1.070	0.64
58_T	111_Q	1.067	0.64
32_K	36_E	1.046	0.62
44_I	48_I	1.039	0.62
60_I	74_Q	1.029	0.61
63_V	88_I	1.022	0.61
60_I	71_L	1.016	0.60
33_R	37_L	0.998	0.59
37_L	80_Q	0.992	0.58
16_L	19_K	0.990	0.58
21_A	110_I	0.978	0.57
91_E	108_F	0.965	0.56
75_L	99_Q	0.964	0.56
50_T	112_I	0.951	0.55
15_L	23_E	0.950	0.55
74_Q	83_R	0.949	0.55
21_A	109_K	0.947	0.55
20_A	24_Q	0.943	0.54
55_Q	64_K	0.938	0.54
45_L	97_L	0.928	0.53
79_A	93_L	0.923	0.53
11_E	14_E	0.922	0.53
10_E	13_E	0.911	0.52
30_E	34_K	0.909	0.52
61_K	94_K	0.879	0.49
37_L	40_Q	0.871	0.49
104_N	108_F	0.863	0.48
12_L	16_L	0.849	0.47
16_L	24_Q	0.848	0.47
42_E	47_V	0.845	0.46
17_R	24_Q	0.844	0.46
22_Q	26_R	0.828	0.45
91_E	94_K	0.810	0.44
35_A	98_E	0.808	0.44
29_E	32_K	0.806	0.43
15_L	115_R	0.805	0.43
52_E	105_R	0.803	0.43
50_T	71_L	0.799	0.43
81_S	85_K	0.798	0.43
18_R	22_Q	0.792	0.42
66_E	70_S	0.790	0.42
46_R	87_P	0.787	0.42
54_R	80_Q	0.787	0.42
36_E	40_Q	0.778	0.41
104_N	107_D	0.775	0.41
87_P	101_S	0.754	0.39
44_I	84_I	0.753	0.39
29_E	33_R	0.752	0.39
34_K	75_L	0.750	0.39
61_K	69_E	0.746	0.39
71_L	85_K	0.734	0.38
39_S	43_S	0.722	0.37
10_E	14_E	0.714	0.36
108_F	114_E	0.711	0.36
15_L	25_K	0.706	0.36
45_L	76_I	0.703	0.35
45_L	53_A	0.703	0.35
42_E	55_Q	0.696	0.35
45_L	49_L	0.685	0.34
88_I	107_D	0.672	0.33
98_E	103_Q	0.671	0.33
108_F	113_R	0.666	0.33
98_E	101_S	0.662	0.33
61_K	68_A	0.661	0.32
44_I	76_I	0.661	0.32
46_R	83_R	0.658	0.32
14_E	112_I	0.651	0.32
64_K	67_F	0.648	0.32
84_I	93_L	0.634	0.31
19_K	23_E	0.628	0.30
21_A	64_K	0.628	0.30
78_L	94_K	0.627	0.30
74_Q	89_T	0.613	0.29
16_L	22_Q	0.611	0.29
79_A	96_I	0.611	0.29
73_N	77_A	0.608	0.29
62_L	81_S	0.606	0.29
29_E	94_K	0.601	0.28
32_K	35_A	0.598	0.28
47_V	115_R	0.590	0.28
46_R	50_T	0.583	0.27
18_R	36_E	0.582	0.27
88_I	92_E	0.574	0.27
26_R	115_R	0.567	0.26
36_E	69_E	0.564	0.26
12_L	73_N	0.562	0.26
15_L	59_N	0.561	0.26
65_P	96_I	0.561	0.26
95_Q	112_I	0.560	0.26
17_R	33_R	0.559	0.26
90_D	95_Q	0.557	0.26
108_F	112_I	0.554	0.25
40_Q	78_L	0.553	0.25
54_R	65_P	0.549	0.25
48_I	94_K	0.549	0.25
73_N	100_I	0.548	0.25
75_L	89_T	0.546	0.25
105_R	109_K	0.545	0.25
50_T	70_S	0.542	0.25
62_L	109_K	0.541	0.25
71_L	96_I	0.534	0.24
18_R	64_K	0.532	0.24
110_I	115_R	0.526	0.24
84_I	114_E	0.525	0.24
42_E	87_P	0.525	0.24
107_D	111_Q	0.524	0.24
63_V	109_K	0.513	0.23
23_E	99_Q	0.513	0.23
9_D	13_E	0.511	0.23
85_K	91_E	0.508	0.23
63_V	102_Q	0.507	0.23
40_Q	43_S	0.504	0.22
43_S	70_S	0.503	0.22
92_E	103_Q	0.501	0.22
46_R	62_L	0.501	0.22
8_D	27_I	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2cruA	1	0.9407	100	0.15	Contact Map
2jxnA	1	0.8983	100	0.161	Contact Map
2fh0A	1	0.6695	100	0.34	Contact Map
1eijA	1	0.6102	99.9	0.346	Contact Map
1yybA	1	0.2203	94.9	0.848	Contact Map
4y66B	1	0.8983	31.2	0.918	Contact Map
3a5tA	2	0.2881	19.3	0.926	Contact Map
4xhmA	1	0.5424	7.4	0.938	Contact Map
2m70A	1	0.839	5.4	0.942	Contact Map
1a0rP	1	0.7373	5.3	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.