Q980F7 - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Q980F7 - 30S ribosomal protein S19e

UniProt:	Q980F7	Sequences: MSLIMITAEMVPPDLLIKRLAIYLKENVKTVDPPEWALLAKTASFKERVPDNAEDWWYIRAASLLRKLYVNSIIGIEKTRTIYGGRKRRGTRPEKFVKAPGHVNRLIFQQLEKAGLVQKIKNKGRSLSPKGRSLLDKLALEIFKELAENNTSLKVYLE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	158 (140)
Sequences:	459 (303)
Seq/√Len:	25.6

HALSA - Q9HNP2
SULSO - Q980F7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
80_R	101_G	5.881	1.00
63_S	83_Y	5.582	1.00
61_A	107_I	4.945	1.00
13_P	17_I	3.999	1.00
57_W	110_Q	3.353	1.00
45_F	85_G	2.617	0.99
65_L	116_L	2.580	0.99
118_Q	126_S	2.559	0.99
99_A	104_N	2.519	0.99
80_R	98_K	2.439	0.99
52_N	59_I	2.309	0.98
102_H	106_L	2.308	0.98
68_L	127_L	2.260	0.98
9_E	70_V	2.012	0.95
88_R	94_E	1.989	0.95
89_R	95_K	1.974	0.95
106_L	109_Q	1.901	0.94
20_L	116_L	1.845	0.93
16_L	20_L	1.835	0.93
67_K	71_N	1.786	0.91
43_A	46_K	1.751	0.91
86_R	94_E	1.636	0.87
68_L	79_T	1.613	0.87
14_D	17_I	1.591	0.86
25_K	55_D	1.573	0.85
87_K	97_V	1.503	0.82
20_L	134_L	1.495	0.82
117_V	127_L	1.467	0.81
108_F	117_V	1.430	0.79
36_W	40_A	1.371	0.76
19_R	141_E	1.343	0.74
12_P	15_L	1.338	0.74
79_T	82_I	1.331	0.74
68_L	117_V	1.313	0.73
74_I	79_T	1.298	0.72
56_W	69_Y	1.282	0.71
7_T	10_M	1.269	0.70
64_L	104_N	1.252	0.69
57_W	106_L	1.246	0.69
6_I	140_L	1.225	0.67
84_G	96_F	1.216	0.67
134_L	138_L	1.210	0.66
100_P	103_V	1.197	0.66
112_E	119_K	1.196	0.65
105_R	125_R	1.175	0.64
6_I	143_F	1.163	0.63
21_A	59_I	1.159	0.63
8_A	16_L	1.156	0.63
126_S	132_R	1.098	0.59
40_A	103_V	1.087	0.58
118_Q	128_S	1.082	0.58
67_K	82_I	1.081	0.57
6_I	128_S	1.081	0.57
8_A	25_K	1.076	0.57
109_Q	112_E	1.064	0.56
133_S	137_K	1.060	0.56
83_Y	117_V	1.056	0.56
7_T	70_V	1.037	0.54
33_P	106_L	1.030	0.54
67_K	81_T	1.020	0.53
43_A	55_D	0.996	0.51
33_P	110_Q	0.994	0.51
136_D	139_A	0.991	0.51
11_V	141_E	0.988	0.51
20_L	65_L	0.963	0.49
115_G	145_E	0.959	0.49
27_N	116_L	0.952	0.48
64_L	79_T	0.950	0.48
21_A	75_G	0.949	0.48
115_G	130_K	0.943	0.47
128_S	146_L	0.942	0.47
98_K	101_G	0.926	0.46
42_T	50_P	0.921	0.46
69_Y	136_D	0.915	0.45
89_R	92_R	0.911	0.45
85_G	111_L	0.906	0.45
23_Y	27_N	0.905	0.45
68_L	74_I	0.901	0.44
43_A	84_G	0.895	0.44
66_R	125_R	0.894	0.44
135_L	138_L	0.881	0.43
16_L	51_D	0.878	0.43
72_S	99_A	0.878	0.43
45_F	97_V	0.873	0.42
21_A	136_D	0.868	0.42
132_R	136_D	0.853	0.41
19_R	22_I	0.845	0.40
25_K	52_N	0.842	0.40
61_A	114_A	0.836	0.40
63_S	68_L	0.832	0.39
18_K	52_N	0.828	0.39
70_V	114_A	0.821	0.39
56_W	90_G	0.819	0.39
71_N	81_T	0.815	0.38
51_D	71_N	0.806	0.38
124_G	131_G	0.805	0.38
31_V	113_K	0.802	0.37
27_N	114_A	0.799	0.37
115_G	137_K	0.791	0.37
38_L	46_K	0.789	0.36
120_I	123_K	0.781	0.36
110_Q	115_G	0.772	0.35
74_I	81_T	0.764	0.35
31_V	79_T	0.764	0.35
44_S	87_K	0.762	0.35
42_T	46_K	0.751	0.34
12_P	120_I	0.749	0.34
101_G	122_N	0.748	0.34
101_G	107_I	0.747	0.34
32_D	35_E	0.734	0.33
45_F	72_S	0.726	0.32
88_R	91_T	0.725	0.32
37_A	114_A	0.722	0.32
17_I	24_L	0.720	0.32
58_Y	106_L	0.718	0.32
33_P	102_H	0.708	0.31
132_R	142_I	0.704	0.31
20_L	107_I	0.703	0.31
79_T	104_N	0.701	0.31
7_T	142_I	0.697	0.30
23_Y	28_V	0.697	0.30
56_W	89_R	0.691	0.30
85_G	96_F	0.688	0.30
31_V	130_K	0.687	0.30
9_E	35_E	0.686	0.30
141_E	146_L	0.681	0.29
129_P	133_S	0.680	0.29
134_L	137_K	0.679	0.29
109_Q	139_A	0.679	0.29
18_K	91_T	0.673	0.29
27_N	32_D	0.673	0.29
112_E	125_R	0.663	0.28
76_I	108_F	0.660	0.28
67_K	83_Y	0.657	0.28
27_N	134_L	0.656	0.28
67_K	74_I	0.656	0.28
31_V	110_Q	0.650	0.28
63_S	140_L	0.643	0.27
33_P	57_W	0.643	0.27
59_I	116_L	0.638	0.27
40_A	50_P	0.634	0.27
68_L	90_G	0.631	0.26
25_K	58_Y	0.621	0.26
6_I	71_N	0.620	0.26
40_A	94_E	0.619	0.26
37_A	142_I	0.616	0.26
31_V	37_A	0.615	0.26
23_Y	138_L	0.606	0.25
130_K	135_L	0.605	0.25
72_S	127_L	0.604	0.25
15_L	48_R	0.601	0.25
133_S	138_L	0.600	0.25
99_A	147_A	0.595	0.24
74_I	110_Q	0.593	0.24
35_E	129_P	0.589	0.24
54_E	59_I	0.587	0.24
105_R	139_A	0.586	0.24
40_A	69_Y	0.586	0.24
48_R	137_K	0.584	0.24
64_L	107_I	0.584	0.24
7_T	132_R	0.581	0.24
110_Q	114_A	0.580	0.24
64_L	120_I	0.576	0.23
15_L	65_L	0.575	0.23
44_S	97_V	0.574	0.23
27_N	70_V	0.573	0.23
118_Q	129_P	0.573	0.23
64_L	78_K	0.573	0.23
68_L	113_K	0.570	0.23
105_R	112_E	0.570	0.23
10_M	139_A	0.566	0.23
71_N	116_L	0.564	0.23
99_A	102_H	0.563	0.23
9_E	72_S	0.563	0.23
77_E	98_K	0.559	0.23
80_R	99_A	0.557	0.22
37_A	110_Q	0.556	0.22
11_V	24_L	0.556	0.22
54_E	63_S	0.554	0.22
33_P	38_L	0.554	0.22
46_K	65_L	0.554	0.22
6_I	9_E	0.552	0.22
85_G	136_D	0.550	0.22
7_T	72_S	0.550	0.22
115_G	144_K	0.550	0.22
41_K	66_R	0.549	0.22
18_K	54_E	0.542	0.22
33_P	37_A	0.540	0.22
35_E	130_K	0.537	0.21
101_G	112_E	0.535	0.21
115_G	138_L	0.533	0.21
47_E	68_L	0.530	0.21
10_M	136_D	0.529	0.21
69_Y	125_R	0.528	0.21
38_L	48_R	0.527	0.21
39_L	57_W	0.526	0.21
87_K	126_S	0.524	0.21
7_T	42_T	0.517	0.21
20_L	123_K	0.515	0.20
16_L	122_N	0.515	0.20
32_D	115_G	0.514	0.20
26_E	32_D	0.514	0.20
104_N	129_P	0.513	0.20
48_R	94_E	0.510	0.20
18_K	113_K	0.510	0.20
34_P	105_R	0.505	0.20
128_S	147_A	0.505	0.20
8_A	134_L	0.502	0.20
27_N	95_K	0.501	0.20
36_W	45_F	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j38T	1	0.9747	100	0.092	Contact Map
4w23T	1	0.8924	100	0.094	Contact Map
4bpeT	1	0.9304	100	0.094	Contact Map
3j7aY	1	0.9241	100	0.096	Contact Map
3zeyO	1	0.943	100	0.105	Contact Map
3j60T	1	0.9177	100	0.106	Contact Map
4ujpU	1	0.8987	100	0.112	Contact Map
2v7fA	1	0.8797	100	0.409	Contact Map
2o0mA	1	0.1013	95.5	0.903	Contact Map
1bjaA	1	0.5949	94.4	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.