RISB - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RISB - 6,7-dimethyl-8-ribityllumazine synthase

UniProt:	Q980B5	Sequences: MQEKSIRLGIVVAEFNYDITQLMLQKALSHARFLNVEVKVVIKVPGTFDMPLAIKKLLEKDFIDAVVTLGAVIKGETKHDELVASQTARKIVDLSTEFNKPVTLGIIGHGATHEQAVERIEEYATRAVEAAIKLVQRTRKLDELKEIKETVIIE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (138)
Sequences:	3210 (1664)
Seq/√Len:	141.6

ECOLI - RISB
BACSU - RISB
HALSA - RISB
SULSO - RISB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
93_D	97_E	3.635	1.00
9_G	57_L	3.361	1.00
12_V	24_L	2.526	1.00
54_I	68_T	2.140	1.00
59_E	99_N	2.125	1.00
55_K	97_E	2.110	1.00
74_K	110_G	2.041	1.00
65_A	134_L	2.020	1.00
18_D	117_V	1.988	1.00
28_L	32_R	1.968	1.00
68_T	91_I	1.960	1.00
24_L	41_V	1.915	1.00
30_H	128_V	1.912	1.00
31_A	36_V	1.904	1.00
50_M	106_I	1.900	1.00
40_V	63_I	1.887	1.00
86_Q	89_R	1.885	1.00
17_Y	21_Q	1.866	1.00
55_K	59_E	1.859	1.00
89_R	93_D	1.819	1.00
76_E	118_E	1.790	1.00
114_E	118_E	1.723	1.00
65_A	131_A	1.686	1.00
87_T	106_I	1.579	1.00
18_D	113_H	1.546	1.00
78_K	81_E	1.543	1.00
56_K	99_N	1.537	1.00
22_L	25_Q	1.528	1.00
55_K	96_T	1.516	1.00
9_G	63_I	1.515	1.00
72_V	83_V	1.510	1.00
123_Y	126_R	1.508	1.00
52_L	95_S	1.483	1.00
42_I	57_L	1.460	1.00
48_F	104_L	1.439	1.00
32_R	38_V	1.383	1.00
21_Q	43_K	1.382	1.00
11_V	54_I	1.376	1.00
58_L	98_F	1.355	1.00
78_K	82_L	1.338	1.00
44_V	53_A	1.334	1.00
19_I	71_A	1.305	1.00
110_G	115_Q	1.296	1.00
81_E	84_A	1.295	1.00
8_L	138_T	1.273	1.00
8_L	31_A	1.235	1.00
58_L	66_V	1.232	1.00
6_I	138_T	1.221	1.00
80_D	84_A	1.215	1.00
72_V	84_A	1.211	1.00
30_H	129_E	1.197	1.00
52_L	141_L	1.194	1.00
13_A	20_T	1.185	1.00
31_A	67_V	1.172	1.00
30_H	33_F	1.170	1.00
126_R	129_E	1.156	0.99
53_A	141_L	1.156	0.99
58_L	100_K	1.153	0.99
11_V	50_M	1.151	0.99
85_S	89_R	1.140	0.99
78_K	110_G	1.130	0.99
12_V	20_T	1.125	0.99
55_K	99_N	1.102	0.99
103_T	130_A	1.082	0.99
51_P	90_K	1.076	0.99
54_I	66_V	1.064	0.99
87_T	104_L	1.062	0.99
29_S	33_F	1.057	0.99
69_L	105_G	1.052	0.99
24_L	43_K	1.029	0.99
55_K	98_F	1.016	0.99
82_L	85_S	1.015	0.99
137_R	140_K	0.999	0.98
30_H	132_I	0.990	0.98
19_I	117_V	0.986	0.98
30_H	34_L	0.982	0.98
125_T	129_E	0.965	0.98
28_L	38_V	0.964	0.98
24_L	28_L	0.958	0.98
59_E	98_F	0.958	0.98
25_Q	29_S	0.955	0.98
92_V	95_S	0.952	0.98
16_N	71_A	0.952	0.98
103_T	133_K	0.945	0.98
6_I	142_D	0.945	0.98
73_I	113_H	0.941	0.98
58_L	94_L	0.940	0.98
54_I	91_I	0.938	0.98
113_H	121_E	0.921	0.97
25_Q	28_L	0.912	0.97
94_L	102_V	0.908	0.97
74_K	78_K	0.908	0.97
17_Y	43_K	0.908	0.97
61_D	100_K	0.906	0.97
6_I	135_V	0.905	0.97
21_Q	25_Q	0.902	0.97
12_V	43_K	0.891	0.97
60_K	63_I	0.887	0.97
34_L	132_I	0.883	0.97
65_A	103_T	0.873	0.96
28_L	41_V	0.868	0.96
51_P	92_V	0.862	0.96
10_I	24_L	0.854	0.96
113_H	117_V	0.851	0.96
80_D	110_G	0.848	0.96
4_K	37_E	0.836	0.95
88_A	104_L	0.833	0.95
14_E	133_K	0.818	0.95
16_N	20_T	0.807	0.94
8_L	36_V	0.804	0.94
50_M	68_T	0.802	0.94
134_L	138_T	0.802	0.94
12_V	41_V	0.796	0.94
7_R	37_E	0.795	0.94
23_M	26_K	0.791	0.94
105_G	127_A	0.791	0.94
66_V	100_K	0.788	0.94
112_T	115_Q	0.783	0.94
79_H	119_R	0.782	0.94
56_K	59_E	0.778	0.93
90_K	94_L	0.775	0.93
113_H	118_E	0.761	0.93
52_L	55_K	0.756	0.92
19_I	113_H	0.755	0.92
48_F	88_A	0.749	0.92
23_M	124_A	0.747	0.92
52_L	56_K	0.743	0.92
118_E	121_E	0.739	0.91
93_D	96_T	0.737	0.91
123_Y	127_A	0.723	0.91
52_L	94_L	0.722	0.90
20_T	71_A	0.719	0.90
59_E	97_E	0.714	0.90
52_L	96_T	0.708	0.90
116_A	119_R	0.707	0.90
50_M	91_I	0.705	0.89
6_I	9_G	0.699	0.89
109_H	116_A	0.696	0.89
133_K	137_R	0.695	0.89
57_L	63_I	0.692	0.89
128_V	132_I	0.685	0.88
53_A	137_R	0.682	0.88
13_A	50_M	0.677	0.87
50_M	87_T	0.672	0.87
56_K	142_D	0.672	0.87
134_L	137_R	0.671	0.87
10_I	27_A	0.669	0.87
12_V	69_L	0.663	0.86
129_E	133_K	0.662	0.86
86_Q	90_K	0.660	0.86
60_K	100_K	0.654	0.86
33_F	125_T	0.654	0.86
9_G	42_I	0.654	0.86
5_S	40_V	0.653	0.86
6_I	139_R	0.650	0.85
14_E	136_Q	0.645	0.85
131_A	135_V	0.642	0.85
82_L	104_L	0.641	0.84
8_L	65_A	0.639	0.84
26_K	124_A	0.635	0.84
48_F	82_L	0.634	0.84
78_K	84_A	0.627	0.83
90_K	96_T	0.626	0.83
77_T	119_R	0.623	0.83
26_K	122_E	0.618	0.82
30_H	125_T	0.613	0.82
19_I	120_I	0.612	0.82
76_E	88_A	0.610	0.81
26_K	120_I	0.608	0.81
22_L	120_I	0.606	0.81
116_A	120_I	0.603	0.81
11_V	66_V	0.603	0.81
13_A	44_V	0.603	0.81
31_A	128_V	0.593	0.80
122_E	134_L	0.592	0.80
26_K	105_G	0.591	0.79
85_S	88_A	0.589	0.79
45_P	134_L	0.588	0.79
8_L	67_V	0.586	0.79
47_T	72_V	0.583	0.78
54_I	94_L	0.582	0.78
48_F	83_V	0.581	0.78
66_V	101_P	0.579	0.78
7_R	61_D	0.568	0.77
14_E	21_Q	0.564	0.76
11_V	57_L	0.563	0.76
6_I	64_D	0.560	0.76
127_A	137_R	0.553	0.75
122_E	125_T	0.553	0.75
80_D	107_I	0.552	0.75
95_S	98_F	0.547	0.74
38_V	41_V	0.545	0.74
40_V	62_F	0.544	0.74
4_K	35_N	0.543	0.73
56_K	138_T	0.542	0.73
103_T	134_L	0.535	0.72
122_E	126_R	0.534	0.72
117_V	120_I	0.529	0.72
13_A	109_H	0.528	0.71
4_K	39_K	0.525	0.71
76_E	121_E	0.517	0.70
36_V	135_V	0.514	0.69
136_Q	140_K	0.510	0.69
138_T	141_L	0.510	0.69
105_G	116_A	0.506	0.68
94_L	98_F	0.500	0.67
11_V	53_A	0.500	0.67

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1rvvA	6	0.9156	100	0.125	Contact Map
1hqkA	6	0.9156	100	0.125	Contact Map
3nq4A	6	0.9091	100	0.128	Contact Map
2i0fA	3	0.8961	100	0.13	Contact Map
2obxA	4	0.9156	100	0.131	Contact Map
1kz1A	5	0.9026	100	0.131	Contact Map
1c41A	6	0.9416	100	0.133	Contact Map
2c92A	3	0.9156	100	0.136	Contact Map
1ejbA	3	0.9221	100	0.136	Contact Map
1c2yA	6	0.9221	100	0.138	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.