CBIX - SULSO - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CBIX - Sirohydrochlorin cobaltochelatase

UniProt:	Q980A7	Sequences: MLGVLLVLHGSKIPEWKDVGIKYAEYLSKYFSLVEFGFLEFNKPTLSEALSNLLAKGADKIVVVPLLFATGTHFRRDIPRLLGIDNDEKKIRYMGREIEITIADPLGFDEKIGEVLVKRVNETYNKNY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	128 (111)
Sequences:	3643 (2445)
Seq/√Len:	232.1

BACSU - SIRB
HALSA - Q9HPL9 CBIX
SULSO - CBIX Q97WC4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_K	99_E	3.614	1.00
45_T	48_E	3.459	1.00
11_S	16_W	2.909	1.00
5_L	49_A	2.892	1.00
35_E	52_N	2.729	1.00
60_K	101_T	2.642	1.00
6_L	24_A	2.485	1.00
21_I	38_F	2.428	1.00
67_L	74_F	2.114	1.00
3_G	53_L	2.004	1.00
40_E	73_H	1.964	1.00
74_F	105_P	1.958	1.00
9_H	73_H	1.941	1.00
62_V	103_A	1.910	1.00
117_V	121_N	1.885	1.00
24_A	36_F	1.804	1.00
43_K	48_E	1.776	1.00
3_G	58_A	1.698	1.00
50_L	100_I	1.681	1.00
83_G	86_N	1.676	1.00
115_V	118_K	1.559	1.00
17_K	42_N	1.543	1.00
39_L	67_L	1.535	1.00
64_V	103_A	1.535	1.00
62_V	101_T	1.474	1.00
67_L	71_G	1.472	1.00
7_V	63_V	1.471	1.00
25_E	28_S	1.466	1.00
50_L	85_D	1.387	1.00
70_T	104_D	1.382	1.00
37_G	49_A	1.340	1.00
35_E	56_K	1.306	1.00
72_T	76_R	1.282	1.00
73_H	79_P	1.281	1.00
8_L	20_G	1.267	1.00
5_L	61_I	1.212	1.00
8_L	38_F	1.188	1.00
26_Y	30_Y	1.184	1.00
82_L	102_I	1.165	1.00
114_E	117_V	1.157	1.00
51_S	55_A	1.149	1.00
14_P	18_D	1.141	1.00
6_L	34_V	1.123	1.00
7_V	46_L	1.111	1.00
26_Y	29_K	1.110	1.00
9_H	40_E	1.099	1.00
15_E	18_D	1.093	1.00
5_L	37_G	1.075	1.00
47_S	81_L	1.073	1.00
38_F	44_P	1.073	1.00
28_S	34_V	1.067	1.00
65_P	74_F	1.056	1.00
86_N	99_E	1.018	1.00
24_A	28_S	1.015	1.00
25_E	29_K	1.012	1.00
5_L	53_L	1.011	1.00
18_D	21_I	1.001	1.00
70_T	75_R	0.988	1.00
33_L	56_K	0.978	1.00
54_L	98_I	0.975	1.00
47_S	84_I	0.967	1.00
20_G	36_F	0.963	1.00
22_K	25_E	0.954	1.00
53_L	58_A	0.944	1.00
102_I	105_P	0.942	1.00
21_I	36_F	0.941	1.00
20_G	38_F	0.938	1.00
81_L	84_I	0.938	1.00
27_L	31_F	0.934	1.00
119_R	122_E	0.929	1.00
23_Y	66_L	0.927	1.00
63_V	82_L	0.917	1.00
17_K	38_F	0.914	1.00
3_G	33_L	0.901	0.99
7_V	37_G	0.893	0.99
118_K	122_E	0.864	0.99
5_L	50_L	0.861	0.99
28_S	31_F	0.837	0.99
21_I	25_E	0.828	0.99
27_L	34_V	0.824	0.99
79_P	82_L	0.817	0.99
7_V	78_I	0.811	0.99
22_K	26_Y	0.800	0.99
3_G	49_A	0.799	0.99
35_E	53_L	0.794	0.99
80_R	84_I	0.767	0.98
49_A	53_L	0.759	0.98
65_P	103_A	0.751	0.98
49_A	52_N	0.749	0.98
24_A	34_V	0.747	0.98
9_H	12_K	0.743	0.98
33_L	58_A	0.729	0.98
82_L	100_I	0.727	0.98
11_S	78_I	0.724	0.98
19_V	22_K	0.723	0.98
39_L	73_H	0.721	0.98
54_L	100_I	0.709	0.97
118_K	121_N	0.709	0.97
9_H	67_L	0.706	0.97
106_L	119_R	0.699	0.97
115_V	119_R	0.699	0.97
52_N	56_K	0.699	0.97
6_L	67_L	0.697	0.97
41_F	71_G	0.695	0.97
13_I	17_K	0.687	0.97
18_D	22_K	0.685	0.97
12_K	41_F	0.682	0.97
7_V	39_L	0.681	0.97
6_L	27_L	0.680	0.97
59_D	97_E	0.679	0.96
17_K	21_I	0.678	0.96
113_G	117_V	0.671	0.96
24_A	27_L	0.669	0.96
5_L	46_L	0.664	0.96
57_G	60_K	0.656	0.96
5_L	63_V	0.654	0.96
22_K	29_K	0.653	0.96
47_S	51_S	0.643	0.95
37_G	102_I	0.637	0.95
8_L	69_A	0.635	0.95
9_H	66_L	0.635	0.95
37_G	63_V	0.631	0.95
59_D	101_T	0.621	0.94
33_L	53_L	0.617	0.94
9_H	23_Y	0.614	0.94
61_I	100_I	0.603	0.93
4_V	62_V	0.601	0.93
39_L	46_L	0.594	0.93
16_W	112_I	0.592	0.93
9_H	41_F	0.592	0.93
45_T	49_A	0.586	0.92
38_F	42_N	0.583	0.92
6_L	20_G	0.582	0.92
40_E	74_F	0.577	0.92
86_N	97_E	0.569	0.91
84_I	87_D	0.564	0.91
71_G	74_F	0.556	0.90
40_E	72_T	0.556	0.90
54_L	58_A	0.553	0.90
73_H	107_G	0.552	0.90
35_E	103_A	0.552	0.90
66_L	71_G	0.546	0.89
39_L	72_T	0.546	0.89
74_F	102_I	0.545	0.89
70_T	108_F	0.545	0.89
12_K	73_H	0.544	0.89
56_K	110_E	0.543	0.89
57_G	98_I	0.542	0.89
81_L	85_D	0.533	0.88
70_T	74_F	0.533	0.88
27_L	64_V	0.532	0.88
9_H	72_T	0.532	0.88
17_K	72_T	0.529	0.88
41_F	73_H	0.526	0.88
28_S	32_S	0.522	0.87
110_E	114_E	0.521	0.87
46_L	81_L	0.511	0.86
40_E	46_L	0.511	0.86
23_Y	39_L	0.507	0.86
40_E	65_P	0.505	0.85
66_L	112_I	0.503	0.85
16_W	38_F	0.503	0.85
47_S	50_L	0.503	0.85
80_R	83_G	0.502	0.85
67_L	72_T	0.501	0.85
40_E	76_R	0.500	0.85

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jh3A	2	0.9688	99.9	0.255	Contact Map
1tjnA	4	0.9375	99.9	0.266	Contact Map
2xwsA	2	0.9453	99.9	0.268	Contact Map
3lyhA	2	0.9297	99.9	0.293	Contact Map
4ccsA	1	0.8516	99.8	0.338	Contact Map
2xvyA	3	0.9531	99.8	0.371	Contact Map
2xwpA	5	0.9375	99.8	0.391	Contact Map
2h1vA	1	0.9297	99.4	0.53	Contact Map
3hcnA	2	0.9453	99.2	0.583	Contact Map
1lbqA	2	0.9219	99.2	0.59	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.